prot_P-wetherbeei_contig9639.2.1 (polypeptide) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig9639.2.1 vs. uniprot
Match: A0A127F274_9HYPH (DUF6460 domain-containing protein n=1 Tax=Rhodoplanes sp. Z2-YC6860 TaxID=674703 RepID=A0A127F274_9HYPH) HSP 1 Score: 59.7 bits (143), Expect = 1.340e-10 Identity = 28/44 (63.64%), Postives = 36/44 (81.82%), Query Frame = 0 Query: 1 MLHPFIRMMVKVAVASLIVGSILAHFGITVDQLIREFGLTPERI 44 M HP IR +VK+AVASLIVG++L HFGIT + LI+EFG + E+I Sbjct: 1 MFHPLIRSLVKIAVASLIVGTVLTHFGITPEMLIKEFGFSYEKI 44
BLAST of mRNA_P-wetherbeei_contig9639.2.1 vs. uniprot
Match: A0A327KLA6_9HYPH (DUF6460 domain-containing protein n=1 Tax=Rhodoplanes roseus TaxID=29409 RepID=A0A327KLA6_9HYPH) HSP 1 Score: 53.5 bits (127), Expect = 3.130e-8 Identity = 24/35 (68.57%), Postives = 32/35 (91.43%), Query Frame = 0 Query: 10 VKVAVASLIVGSILAHFGITVDQLIREFGLTPERI 44 VK+AVASLIVG++LAHFGIT+D L +E G++PER+ Sbjct: 6 VKIAVASLIVGTVLAHFGITLDALTKELGVSPERL 40
BLAST of mRNA_P-wetherbeei_contig9639.2.1 vs. uniprot
Match: A0A327K3P0_9HYPH (DUF6460 domain-containing protein n=2 Tax=Rhodoplanes elegans TaxID=29408 RepID=A0A327K3P0_9HYPH) HSP 1 Score: 52.4 bits (124), Expect = 8.950e-8 Identity = 23/34 (67.65%), Postives = 31/34 (91.18%), Query Frame = 0 Query: 11 KVAVASLIVGSILAHFGITVDQLIREFGLTPERI 44 K+AVASLIVG++LAHFGIT+D L+ E G++PER+ Sbjct: 7 KIAVASLIVGTVLAHFGITLDALVGELGVSPERL 40
BLAST of mRNA_P-wetherbeei_contig9639.2.1 vs. uniprot
Match: A0A327K3Q4_9HYPH (Uncharacterized protein n=2 Tax=Rhodoplanes piscinae TaxID=444923 RepID=A0A327K3Q4_9HYPH) HSP 1 Score: 51.2 bits (121), Expect = 2.560e-7 Identity = 24/35 (68.57%), Postives = 31/35 (88.57%), Query Frame = 0 Query: 10 VKVAVASLIVGSILAHFGITVDQLIREFGLTPERI 44 VK+AVASLIVG+ILAHFGIT++ L E G++PER+ Sbjct: 6 VKIAVASLIVGTILAHFGITLETLAGELGISPERL 40
BLAST of mRNA_P-wetherbeei_contig9639.2.1 vs. uniprot
Match: UPI00185F1FC3 (Uncharacterized protein n=1 Tax=Rhodoplanes sp. TaxID=1968906 RepID=UPI00185F1FC3) HSP 1 Score: 49.3 bits (116), Expect = 1.570e-6 Identity = 22/35 (62.86%), Postives = 30/35 (85.71%), Query Frame = 0 Query: 10 VKVAVASLIVGSILAHFGITVDQLIREFGLTPERI 44 VK+AVASLIVG++LAHFGIT + + E G++PER+ Sbjct: 9 VKIAVASLIVGTVLAHFGITFEAMSTELGISPERL 43
BLAST of mRNA_P-wetherbeei_contig9639.2.1 vs. uniprot
Match: A0A833GEN3_9HYPH (DUF6460 domain-containing protein n=1 Tax=Pseudorhodoplanes sp. TaxID=1934341 RepID=A0A833GEN3_9HYPH) HSP 1 Score: 47.8 bits (112), Expect = 4.440e-6 Identity = 20/26 (76.92%), Postives = 24/26 (92.31%), Query Frame = 0 Query: 19 VGSILAHFGITVDQLIREFGLTPERI 44 VG+ILAHFGIT + LIREFG+TPER+ Sbjct: 2 VGTILAHFGITAEHLIREFGMTPERV 27
BLAST of mRNA_P-wetherbeei_contig9639.2.1 vs. uniprot
Match: J6IYR2_9RHOB (DUF6460 domain-containing protein n=1 Tax=Rhodovulum sp. PH10 TaxID=1187851 RepID=J6IYR2_9RHOB) HSP 1 Score: 45.1 bits (105), Expect = 6.710e-5 Identity = 22/34 (64.71%), Postives = 27/34 (79.41%), Query Frame = 0 Query: 11 KVAVASLIVGSILAHFGITVDQLIREFGLTPERI 44 KVAVASLIVG+I HFGIT++ L E GL+ ER+ Sbjct: 6 KVAVASLIVGTIFGHFGITLETLANELGLSFERV 39 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig9639.2.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 7
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-wetherbeei_contig9639.2.1 ID=prot_P-wetherbeei_contig9639.2.1|Name=mRNA_P-wetherbeei_contig9639.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=44bpback to top |