prot_P-wetherbeei_contig9604.1.1 (polypeptide) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig9604.1.1 vs. uniprot
Match: D7G4J4_ECTSI (RING-type domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G4J4_ECTSI) HSP 1 Score: 65.1 bits (157), Expect = 6.040e-8 Identity = 26/41 (63.41%), Postives = 32/41 (78.05%), Query Frame = 0 Query: 246 DEFKCPICWEMLARPVTLMCGHTACEVCVAQHFKTQIHRAA 286 D+F+C ICWEMLARPVTL CGHTACE C+A++ + Q A Sbjct: 185 DDFQCNICWEMLARPVTLACGHTACESCMAKYLRAQAQAQA 225
BLAST of mRNA_P-wetherbeei_contig9604.1.1 vs. uniprot
Match: A0A6H5JAA6_9PHAE (RING-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JAA6_9PHAE) HSP 1 Score: 65.1 bits (157), Expect = 6.580e-8 Identity = 26/41 (63.41%), Postives = 32/41 (78.05%), Query Frame = 0 Query: 246 DEFKCPICWEMLARPVTLMCGHTACEVCVAQHFKTQIHRAA 286 D+F+C ICWEMLARPVTL CGHTACE C+A++ + Q A Sbjct: 440 DDFQCNICWEMLARPVTLACGHTACESCMAKYLRAQAQAQA 480
BLAST of mRNA_P-wetherbeei_contig9604.1.1 vs. uniprot
Match: A0A835Z6P8_9STRA (RING-type domain-containing protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835Z6P8_9STRA) HSP 1 Score: 62.4 bits (150), Expect = 4.140e-7 Identity = 25/44 (56.82%), Postives = 30/44 (68.18%), Query Frame = 0 Query: 246 DEFKCPICWEMLARPVTLMCGHTACEVCVAQHFKTQIHRAAAGP 289 DEF CPICW++L RPV+L CGHT CE C A + TQ+ A P Sbjct: 135 DEFMCPICWDLLCRPVSLECGHTLCEKCCALYLDTQLRNQTAIP 178 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig9604.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 3
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-wetherbeei_contig9604.1.1 ID=prot_P-wetherbeei_contig9604.1.1|Name=mRNA_P-wetherbeei_contig9604.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=317bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|