prot_P-wetherbeei_contig9584.4.1 (polypeptide) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig9584.4.1 vs. uniprot
Match: F8C0T3_AFIC5 (Uncharacterized protein n=1 Tax=Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5) TaxID=504832 RepID=F8C0T3_AFIC5) HSP 1 Score: 53.5 bits (127), Expect = 2.060e-7 Identity = 35/81 (43.21%), Postives = 45/81 (55.56%), Query Frame = 0 Query: 11 LLRKIEPIVRRSSFTNKDAVTQGNNTGRLATSDAMLNHLAMLQNERPGDSARIRNAYLAICFAIQARIDLLFTMSEIPQTA 91 +LRKI+P+ RSS NKD T + A M+ P +I + +LA+ F IQARIDLLFTMS+IPQ A Sbjct: 1 MLRKIDPMAMRSSVANKDHFTTRTSCDARAPK--------MIWRYAP----KIHDTHLAMRFMIQARIDLLFTMSDIPQAA 69 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig9584.4.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-wetherbeei_contig9584.4.1 ID=prot_P-wetherbeei_contig9584.4.1|Name=mRNA_P-wetherbeei_contig9584.4.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=94bpback to top |