mRNA_P-wetherbeei_contig9584.4.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig9584.4.1 vs. uniprot
Match: F8C0T3_AFIC5 (Uncharacterized protein n=1 Tax=Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5) TaxID=504832 RepID=F8C0T3_AFIC5) HSP 1 Score: 53.5 bits (127), Expect = 2.060e-7 Identity = 35/81 (43.21%), Postives = 45/81 (55.56%), Query Frame = 1 Query: 31 LLRKIEPIVRRSSFTNKDAVTQGNNTGRLATSDAMLNHLAMLQNERPGDSARIRNAYLAICFAIQARIDLLFTMSEIPQTA 273 +LRKI+P+ RSS NKD T + A M+ P +I + +LA+ F IQARIDLLFTMS+IPQ A Sbjct: 1 MLRKIDPMAMRSSVANKDHFTTRTSCDARAPK--------MIWRYAP----KIHDTHLAMRFMIQARIDLLFTMSDIPQAA 69 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig9584.4.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig9584.4.1 >prot_P-wetherbeei_contig9584.4.1 ID=prot_P-wetherbeei_contig9584.4.1|Name=mRNA_P-wetherbeei_contig9584.4.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=94bp MQLDMIRKTSLLRKIEPIVRRSSFTNKDAVTQGNNTGRLATSDAMLNHLAback to top mRNA from alignment at P-wetherbeei_contig9584:1096..1377- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig9584.4.1 ID=mRNA_P-wetherbeei_contig9584.4.1|Name=mRNA_P-wetherbeei_contig9584.4.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=282bp|location=Sequence derived from alignment at P-wetherbeei_contig9584:1096..1377- (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig9584:1096..1377- >mRNA_P-wetherbeei_contig9584.4.1 ID=mRNA_P-wetherbeei_contig9584.4.1|Name=mRNA_P-wetherbeei_contig9584.4.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=282bp|location=Sequence derived from alignment at P-wetherbeei_contig9584:1096..1377- (Phaeothamnion wetherbeei SAG_119_79)back to top |