|
|
Homology
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
| IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
| IPR019734 | Tetratricopeptide repeat | SMART | SM00028 | tpr_5 | coord: 275..308 e-value: 2.1E-10 score: 50.6 coord: 241..274 e-value: 3.0E-5 score: 33.4 coord: 105..138 e-value: 0.15 score: 21.2 coord: 309..342 e-value: 1.8E-7 score: 40.8 coord: 173..206 e-value: 4.1E-7 score: 39.6 coord: 207..240 e-value: 8.3E-5 score: 32.0 coord: 139..172 e-value: 3.7E-4 score: 29.8 coord: 343..376 e-value: 6.8E-8 score: 42.2 coord: 70..103 e-value: 1.2E-6 score: 38.1 coord: 36..69 e-value: 5.7E-7 score: 39.2 |
| IPR019734 | Tetratricopeptide repeat | PFAM | PF13181 | TPR_8 | coord: 142..172 e-value: 0.072 score: 13.3 coord: 107..137 e-value: 0.088 score: 13.0 |
| IPR019734 | Tetratricopeptide repeat | PROSITE | PS50005 | TPR | coord: 105..138 score: 9.0569 |
| IPR019734 | Tetratricopeptide repeat | PROSITE | PS50005 | TPR | coord: 343..376 score: 13.2754 |
| IPR019734 | Tetratricopeptide repeat | PROSITE | PS50005 | TPR | coord: 70..103 score: 9.3224 |
| IPR019734 | Tetratricopeptide repeat | PROSITE | PS50005 | TPR | coord: 309..342 score: 13.1574 |
| IPR019734 | Tetratricopeptide repeat | PROSITE | PS50005 | TPR | coord: 36..69 score: 12.3019 |
| IPR019734 | Tetratricopeptide repeat | PROSITE | PS50005 | TPR | coord: 207..240 score: 11.9774 |
| IPR019734 | Tetratricopeptide repeat | PROSITE | PS50005 | TPR | coord: 173..206 score: 11.711901 |
| IPR019734 | Tetratricopeptide repeat | PROSITE | PS50005 | TPR | coord: 241..274 score: 9.4109 |
| IPR019734 | Tetratricopeptide repeat | PROSITE | PS50005 | TPR | coord: 139..172 score: 9.4404 |
| IPR019734 | Tetratricopeptide repeat | PROSITE | PS50005 | TPR | coord: 275..308 score: 14.0424 |
| None | No IPR available | PFAM | PF13414 | TPR_11 | coord: 350..391 e-value: 9.6E-11 score: 41.2 coord: 43..84 e-value: 1.2E-10 score: 40.9 coord: 282..320 e-value: 5.1E-13 score: 48.5 coord: 214..255 e-value: 3.1E-8 score: 33.2 |
| None | No IPR available | PANTHER | PTHR44858 | TETRATRICOPEPTIDE REPEAT PROTEIN 6 | coord: 325..400 |
| None | No IPR available | PANTHER | PTHR44858 | TETRATRICOPEPTIDE REPEAT PROTEIN 6 | coord: 156..375 |
| None | No IPR available | PANTHER | PTHR44858 | TETRATRICOPEPTIDE REPEAT PROTEIN 6 | coord: 37..109 |
| None | No IPR available | PANTHER | PTHR44858 | TETRATRICOPEPTIDE REPEAT PROTEIN 6 | coord: 81..159 coord: 121..199 |
| None | No IPR available | PANTHER | PTHR44858:SF10 | SUBFAMILY NOT NAMED | coord: 81..159 coord: 121..199 |
| None | No IPR available | PANTHER | PTHR44858:SF10 | SUBFAMILY NOT NAMED | coord: 156..375 |
| None | No IPR available | PANTHER | PTHR44858:SF10 | SUBFAMILY NOT NAMED | coord: 325..400 |
| None | No IPR available | PANTHER | PTHR44858:SF10 | SUBFAMILY NOT NAMED | coord: 37..109 |
| None | No IPR available | PROSITE | PS50293 | TPR_REGION | coord: 36..69 score: 9.563738 |
| None | No IPR available | PROSITE | PS50293 | TPR_REGION | coord: 309..342 score: 10.540613 |
| None | No IPR available | PROSITE | PS50293 | TPR_REGION | coord: 173..205 score: 9.428996 |
| None | No IPR available | PROSITE | PS50293 | TPR_REGION | coord: 343..376 score: 10.641669 |
| None | No IPR available | PROSITE | PS50293 | TPR_REGION | coord: 275..307 score: 11.786971 |
| None | No IPR available | PROSITE | PS50293 | TPR_REGION | coord: 207..240 score: 8.856345 |
| IPR011990 | Tetratricopeptide-like helical domain superfamily | GENE3D | 1.25.40.10 | Tetratricopeptide repeat domain | coord: 311..401 e-value: 3.9E-29 score: 104.1 |
| IPR011990 | Tetratricopeptide-like helical domain superfamily | GENE3D | 1.25.40.10 | Tetratricopeptide repeat domain | coord: 17..102 e-value: 1.3E-19 score: 72.4 |
| IPR011990 | Tetratricopeptide-like helical domain superfamily | GENE3D | 1.25.40.10 | Tetratricopeptide repeat domain | coord: 103..171 e-value: 6.6E-16 score: 60.3 |
| IPR011990 | Tetratricopeptide-like helical domain superfamily | GENE3D | 1.25.40.10 | Tetratricopeptide repeat domain | coord: 172..239 e-value: 1.0E-20 score: 76.3 coord: 240..310 e-value: 1.7E-21 score: 78.8 |
| IPR011990 | Tetratricopeptide-like helical domain superfamily | SUPERFAMILY | 48452 | TPR-like | coord: 305..400 |
| IPR011990 | Tetratricopeptide-like helical domain superfamily | SUPERFAMILY | 48452 | TPR-like | coord: 36..329 |
| IPR001440 | Tetratricopeptide repeat 1 | PFAM | PF00515 | TPR_1 | coord: 173..206 e-value: 1.4E-8 score: 34.2 |
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-wetherbeei_contig16132.1.1 ID=prot_P-wetherbeei_contig16132.1.1|Name=mRNA_P-wetherbeei_contig16132.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=401bp MAAKGPCFVKEAAPDVLIAACTTVIDSGKEKSTILAQAYAARGEAYREQG NHDEAIRDLDQAIKLDAKNGNAYYNRGLSHRAKGEFDSAIADYDLAIKHD SKNASTIYNSRSHANYDKRDYEHAIGDLNQAIRLNPRYTLAIYNRAMAFR AKGEPERAVPDFDAVLKVNPNDAFAYHNRGLAYRDLRDYDRAIRDFDQAV KINANFIQAFNDRGLAYISKGETDRAIEDFDHAVLLNPKDPAAFNNRGLA YRNKGETDAAINNYDQSIALNAEFALAYYNRGNAYYDKRDYDRAITDYNQ AIRINPNYALAYYDRGVVYYDRHDYDRAVADLSQAIQLDPKDSLAYYNRG LTFRAKGEMDRALADFDQAIKLDPKNPLPFYNRGLAYRDKGEQDKAIGDF S back to top
Annotated Terms
The following terms have been associated with this polypeptide:
|