prot_P-wetherbeei_contig11411.1.1 (polypeptide) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig11411.1.1 vs. uniprot
Match: D8LLV3_ECTSI (DUF3730 domain-containing protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D8LLV3_ECTSI) HSP 1 Score: 75.1 bits (183), Expect = 1.580e-10 Identity = 42/77 (54.55%), Postives = 53/77 (68.83%), Query Frame = 0 Query: 1 SQDEDEVRLAKAAAVLDAVRHDPERGVEFVVVLQALMSDRLPGVAALALRAVASLCRSNCLDFGAALRIVCLPGKVS 77 S + DE RL +AA +L+ DPE G+E V LQ + D V ALAL+A+A+LCRS+CLDFGAALRIV GKV+ Sbjct: 622 SPEPDESRLCRAAGMLEICETDPELGLECVRPLQGFLGDGSSAVTALALKAIAALCRSDCLDFGAALRIVTKKGKVA 698
BLAST of mRNA_P-wetherbeei_contig11411.1.1 vs. uniprot
Match: A0A836CP61_9STRA (DUF3730 domain-containing protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836CP61_9STRA) HSP 1 Score: 70.9 bits (172), Expect = 3.260e-9 Identity = 41/73 (56.16%), Postives = 47/73 (64.38%), Query Frame = 0 Query: 5 DEVRLAKAAAVLDAVRHDPERGVEFVVVLQALMSDRLPGVAALALRAVASLCRSNCLDFGAALRIVCLPGKVS 77 D +RLA AA + + DPE GVEFV LQA M D LPGVAALAL+ R +CLDF ALRIV GK+S Sbjct: 600 DSMRLAAAATLSQLCQRDPEEGVEFVPQLQAYMQDALPGVAALALQXXXXXARQDCLDFALALRIVKKKGKLS 672
BLAST of mRNA_P-wetherbeei_contig11411.1.1 vs. uniprot
Match: A0A5D6XN50_9STRA (DUF3730 domain-containing protein n=1 Tax=Pythium brassicum TaxID=1485010 RepID=A0A5D6XN50_9STRA) HSP 1 Score: 60.1 bits (144), Expect = 7.880e-6 Identity = 34/80 (42.50%), Postives = 46/80 (57.50%), Query Frame = 0 Query: 6 EVRLAKAAAVLDAVRHDPERGVEFVVVLQALMSDRLPGVAALALRAVASLCRSNCLDFGAALRIVCLPGKVSFLEPLTAP 85 E L K A + R DPE GVE++ +QA + D VAA+AL A+ SLC+++CLDF +IV L K + L AP Sbjct: 516 EYELVKVATIDALCRKDPELGVEYISQIQAFLEDERVSVAAMALNAIESLCKADCLDFYVVFKIVSLKIKKKKIRCLEAP 595 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig11411.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 3
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-wetherbeei_contig11411.1.1 ID=prot_P-wetherbeei_contig11411.1.1|Name=mRNA_P-wetherbeei_contig11411.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=464bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|