prot_P-wetherbeei_contig11387.2.1 (polypeptide) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig11387.2.1 vs. uniprot
Match: A0A835Z0A0_9STRA (Histidine phosphatase superfamily n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835Z0A0_9STRA) HSP 1 Score: 61.2 bits (147), Expect = 2.800e-9 Identity = 33/70 (47.14%), Postives = 43/70 (61.43%), Query Frame = 0 Query: 2 YAAWLVPDATRPSPLLEEIQRLHAASRADPRVRSAASLLPERGGGRLHIALSDFVPMRYDALHVLCSALR 71 YA WL PD + P PLL E R AA+RAD +R + R GGRLH+ALS F+P+ ++ + L ALR Sbjct: 232 YAVWLEPDRSAPPPLLAEHDRFCAAARADAALRDCTFIA--RRGGRLHVALSSFLPLPFELVQRLGLALR 299 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig11387.2.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-wetherbeei_contig11387.2.1 ID=prot_P-wetherbeei_contig11387.2.1|Name=mRNA_P-wetherbeei_contig11387.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=71bpback to top |