mRNA_P-wetherbeei_contig11387.2.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig11387.2.1 vs. uniprot
Match: A0A835Z0A0_9STRA (Histidine phosphatase superfamily n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835Z0A0_9STRA) HSP 1 Score: 61.2 bits (147), Expect = 2.800e-9 Identity = 33/70 (47.14%), Postives = 43/70 (61.43%), Query Frame = 1 Query: 4 YAAWLVPDATRPSPLLEEIQRLHAASRADPRVRSAASLLPERGGGRLHIALSDFVPMRYDALHVLCSALR 213 YA WL PD + P PLL E R AA+RAD +R + R GGRLH+ALS F+P+ ++ + L ALR Sbjct: 232 YAVWLEPDRSAPPPLLAEHDRFCAAARADAALRDCTFIA--RRGGRLHVALSSFLPLPFELVQRLGLALR 299 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig11387.2.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig11387.2.1 >prot_P-wetherbeei_contig11387.2.1 ID=prot_P-wetherbeei_contig11387.2.1|Name=mRNA_P-wetherbeei_contig11387.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=71bp EYAAWLVPDATRPSPLLEEIQRLHAASRADPRVRSAASLLPERGGGRLHIback to top mRNA from alignment at P-wetherbeei_contig11387:1792..2004+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig11387.2.1 ID=mRNA_P-wetherbeei_contig11387.2.1|Name=mRNA_P-wetherbeei_contig11387.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=213bp|location=Sequence derived from alignment at P-wetherbeei_contig11387:1792..2004+ (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig11387:1792..2004+ >mRNA_P-wetherbeei_contig11387.2.1 ID=mRNA_P-wetherbeei_contig11387.2.1|Name=mRNA_P-wetherbeei_contig11387.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=213bp|location=Sequence derived from alignment at P-wetherbeei_contig11387:1792..2004+ (Phaeothamnion wetherbeei SAG_119_79)back to top |