mRNA_P-wetherbeei_contig9789.3.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig9789.3.1 vs. uniprot
Match: UPI001BCABC09 (hypothetical protein n=1 Tax=Ancylobacter lacus TaxID=2579970 RepID=UPI001BCABC09) HSP 1 Score: 50.8 bits (120), Expect = 1.920e-7 Identity = 26/41 (63.41%), Postives = 31/41 (75.61%), Query Frame = 1 Query: 1 ETTRRQRYRSRAIALGLGALVVIFYVATLVRLGPNALRKDL 123 E RRQR RS AIA+ LGAL V+FYV T+V+LGPN L + L Sbjct: 18 EQKRRQRSRSIAIAVVLGALCVLFYVVTIVKLGPNVLNRPL 58
BLAST of mRNA_P-wetherbeei_contig9789.3.1 vs. uniprot
Match: UPI00182F55DD (Uncharacterized protein n=1 Tax=Rhodoplanes sp. TaxID=1968906 RepID=UPI00182F55DD) HSP 1 Score: 49.7 bits (117), Expect = 5.380e-7 Identity = 25/41 (60.98%), Postives = 30/41 (73.17%), Query Frame = 1 Query: 1 ETTRRQRYRSRAIALGLGALVVIFYVATLVRLGPNALRKDL 123 E RRQR RS AIA+ LGALVV+FY T+V+LGP L + L Sbjct: 17 EQKRRQRARSVAIAVALGALVVLFYAITIVKLGPGVLNRPL 57
BLAST of mRNA_P-wetherbeei_contig9789.3.1 vs. uniprot
Match: A0A562T1P8_9HYPH (Uncharacterized protein n=1 Tax=Roseibium hamelinense TaxID=150831 RepID=A0A562T1P8_9HYPH) HSP 1 Score: 48.5 bits (114), Expect = 1.410e-6 Identity = 23/41 (56.10%), Postives = 31/41 (75.61%), Query Frame = 1 Query: 1 ETTRRQRYRSRAIALGLGALVVIFYVATLVRLGPNALRKDL 123 E T+R+R RS AIA LGALVV+FYV T+V++GP + + L Sbjct: 13 EQTKRRRSRSIAIAFALGALVVLFYVVTIVKMGPEIMNRAL 53
BLAST of mRNA_P-wetherbeei_contig9789.3.1 vs. uniprot
Match: UPI0004945AB4 (hypothetical protein n=1 Tax=Bosea sp. 117 TaxID=1125973 RepID=UPI0004945AB4) HSP 1 Score: 48.5 bits (114), Expect = 1.650e-6 Identity = 25/41 (60.98%), Postives = 30/41 (73.17%), Query Frame = 1 Query: 1 ETTRRQRYRSRAIALGLGALVVIFYVATLVRLGPNALRKDL 123 E RR+R RS AIAL LGAL V+FYV T+V+LGP L + L Sbjct: 20 EQKRRRRARSLAIALVLGALCVLFYVVTIVKLGPGVLNRPL 60
BLAST of mRNA_P-wetherbeei_contig9789.3.1 vs. uniprot
Match: A0A7W2BT31_9HYPH (Uncharacterized protein n=1 Tax=Hyphomicrobiales bacterium TaxID=1909294 RepID=A0A7W2BT31_9HYPH) HSP 1 Score: 48.1 bits (113), Expect = 2.400e-6 Identity = 25/41 (60.98%), Postives = 30/41 (73.17%), Query Frame = 1 Query: 1 ETTRRQRYRSRAIALGLGALVVIFYVATLVRLGPNALRKDL 123 E RR+R RS AIA LG LVV+FYV T+V+LGPN L + L Sbjct: 21 EQRRRRRARSIAIAAVLGFLVVLFYVVTIVKLGPNVLNRPL 61
BLAST of mRNA_P-wetherbeei_contig9789.3.1 vs. uniprot
Match: UPI001BCC127B (hypothetical protein n=1 Tax=Chelatococcus sp. YT9 TaxID=2835635 RepID=UPI001BCC127B) HSP 1 Score: 48.1 bits (113), Expect = 4.020e-6 Identity = 24/39 (61.54%), Postives = 30/39 (76.92%), Query Frame = 1 Query: 7 TRRQRYRSRAIALGLGALVVIFYVATLVRLGPNALRKDL 123 TRR+R R+ AIAL LGALV++FYV TL RLG N + + L Sbjct: 46 TRRRRTRNIAIALTLGALVILFYVMTLARLGSNVMNRPL 84
BLAST of mRNA_P-wetherbeei_contig9789.3.1 vs. uniprot
Match: UPI001FF6C23F (hypothetical protein n=1 Tax=Ancylobacter sp. 6x-1 TaxID=2579147 RepID=UPI001FF6C23F) HSP 1 Score: 47.4 bits (111), Expect = 4.730e-6 Identity = 23/41 (56.10%), Postives = 30/41 (73.17%), Query Frame = 1 Query: 1 ETTRRQRYRSRAIALGLGALVVIFYVATLVRLGPNALRKDL 123 E RR+R RS AIAL LG L ++FY+ T+V+LGPN L + L Sbjct: 20 EQKRRRRSRSVAIALVLGGLCLLFYIVTIVKLGPNVLNRPL 60
BLAST of mRNA_P-wetherbeei_contig9789.3.1 vs. uniprot
Match: B0UFS1_METS4 (Conserved protein CoxF n=1 Tax=Methylobacterium sp. (strain 4-46) TaxID=426117 RepID=B0UFS1_METS4) HSP 1 Score: 46.2 bits (108), Expect = 1.090e-5 Identity = 24/41 (58.54%), Postives = 28/41 (68.29%), Query Frame = 1 Query: 1 ETTRRQRYRSRAIALGLGALVVIFYVATLVRLGPNALRKDL 123 E RR+R RS AIAL L ALV IFYV T+ +LGP L + L Sbjct: 10 EEARRRRKRSLAIALTLAALVAIFYVLTIAKLGPQVLNRPL 50
BLAST of mRNA_P-wetherbeei_contig9789.3.1 vs. uniprot
Match: A0A1M7AT32_9HYPH (Uncharacterized protein n=2 Tax=Roseibium TaxID=150830 RepID=A0A1M7AT32_9HYPH) HSP 1 Score: 46.2 bits (108), Expect = 1.160e-5 Identity = 22/41 (53.66%), Postives = 31/41 (75.61%), Query Frame = 1 Query: 1 ETTRRQRYRSRAIALGLGALVVIFYVATLVRLGPNALRKDL 123 E +R+R RS AIAL LGALV++FYV T+V++GP + + L Sbjct: 13 EQAKRRRARSVAIALTLGALVLLFYVVTIVKMGPQIMSRPL 53
BLAST of mRNA_P-wetherbeei_contig9789.3.1 vs. uniprot
Match: UPI0014042491 (hypothetical protein n=1 Tax=Labrenzia sp. 011 TaxID=2171494 RepID=UPI0014042491) HSP 1 Score: 46.2 bits (108), Expect = 1.160e-5 Identity = 23/41 (56.10%), Postives = 31/41 (75.61%), Query Frame = 1 Query: 1 ETTRRQRYRSRAIALGLGALVVIFYVATLVRLGPNALRKDL 123 E R++R RS AIA+ LGALVV+FYV T+V+LGP + + L Sbjct: 13 EQKRKRRARSIAIAVVLGALVVLFYVVTIVKLGPGVIDRPL 53 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig9789.3.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig9789.3.1 >prot_P-wetherbeei_contig9789.3.1 ID=prot_P-wetherbeei_contig9789.3.1|Name=mRNA_P-wetherbeei_contig9789.3.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=41bp ETTRRQRYRSRAIALGLGALVVIFYVATLVRLGPNALRKDLback to top mRNA from alignment at P-wetherbeei_contig9789:1893..2015- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig9789.3.1 ID=mRNA_P-wetherbeei_contig9789.3.1|Name=mRNA_P-wetherbeei_contig9789.3.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=123bp|location=Sequence derived from alignment at P-wetherbeei_contig9789:1893..2015- (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig9789:1893..2015- >mRNA_P-wetherbeei_contig9789.3.1 ID=mRNA_P-wetherbeei_contig9789.3.1|Name=mRNA_P-wetherbeei_contig9789.3.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=123bp|location=Sequence derived from alignment at P-wetherbeei_contig9789:1893..2015- (Phaeothamnion wetherbeei SAG_119_79)back to top |