mRNA_P-wetherbeei_contig9760.1.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig9760.1.1 vs. uniprot
Match: A0A812SEL5_9DINO (Ari-2 protein n=1 Tax=Symbiodinium sp. CCMP2592 TaxID=631055 RepID=A0A812SEL5_9DINO) HSP 1 Score: 66.6 bits (161), Expect = 8.480e-12 Identity = 25/40 (62.50%), Postives = 32/40 (80.00%), Query Frame = 1 Query: 1 GVKRCPSCSVWIEKDGGCSHMSCSACRGEFCWRCRSRWSG 120 GV++CP+C V I K+GGCSHM+C+ CR EFCW+C WSG Sbjct: 264 GVRKCPNCHVPILKNGGCSHMTCTRCRHEFCWQCGGAWSG 303
BLAST of mRNA_P-wetherbeei_contig9760.1.1 vs. uniprot
Match: A0A067BQQ6_SAPPC (Uncharacterized protein n=1 Tax=Saprolegnia parasitica (strain CBS 223.65) TaxID=695850 RepID=A0A067BQQ6_SAPPC) HSP 1 Score: 66.6 bits (161), Expect = 9.780e-12 Identity = 24/39 (61.54%), Postives = 30/39 (76.92%), Query Frame = 1 Query: 1 GVKRCPSCSVWIEKDGGCSHMSCSACRGEFCWRCRSRWS 117 G +RCP CS IEKDGGCSH+ C+ C +FCWRCR +W+ Sbjct: 374 GAQRCPCCSTTIEKDGGCSHIKCTYCHYDFCWRCRVKWA 412
BLAST of mRNA_P-wetherbeei_contig9760.1.1 vs. uniprot
Match: T0Q9M7_SAPDV (Uncharacterized protein n=1 Tax=Saprolegnia diclina (strain VS20) TaxID=1156394 RepID=T0Q9M7_SAPDV) HSP 1 Score: 66.2 bits (160), Expect = 1.340e-11 Identity = 24/38 (63.16%), Postives = 29/38 (76.32%), Query Frame = 1 Query: 4 VKRCPSCSVWIEKDGGCSHMSCSACRGEFCWRCRSRWS 117 +RCP CS IEKDGGCSHM C+ C +FCWRCR +W+ Sbjct: 459 AQRCPQCSTTIEKDGGCSHMKCTYCHYDFCWRCRIKWA 496
BLAST of mRNA_P-wetherbeei_contig9760.1.1 vs. uniprot
Match: A0A067BRD1_SAPPC (RING-type domain-containing protein n=1 Tax=Saprolegnia parasitica (strain CBS 223.65) TaxID=695850 RepID=A0A067BRD1_SAPPC) HSP 1 Score: 64.7 bits (156), Expect = 1.660e-11 Identity = 23/38 (60.53%), Postives = 29/38 (76.32%), Query Frame = 1 Query: 4 VKRCPSCSVWIEKDGGCSHMSCSACRGEFCWRCRSRWS 117 +RCP CS IEKDGGCSH+ C+ C +FCWRCR +W+ Sbjct: 150 AQRCPQCSTTIEKDGGCSHIKCTYCHYDFCWRCRVKWA 187
BLAST of mRNA_P-wetherbeei_contig9760.1.1 vs. uniprot
Match: A0A2T7NVN1_POMCA (RBR-type E3 ubiquitin transferase n=1 Tax=Pomacea canaliculata TaxID=400727 RepID=A0A2T7NVN1_POMCA) HSP 1 Score: 64.3 bits (155), Expect = 6.370e-11 Identity = 24/37 (64.86%), Postives = 29/37 (78.38%), Query Frame = 1 Query: 4 VKRCPSCSVWIEKDGGCSHMSCSACRGEFCWRCRSRW 114 VKRCP C+ IEK+GGCSHM+C+ C EFCW C+S W Sbjct: 803 VKRCPQCAYPIEKNGGCSHMTCTRCHKEFCWTCKSDW 839
BLAST of mRNA_P-wetherbeei_contig9760.1.1 vs. uniprot
Match: A0A6P8HWK5_ACTTE (RBR-type E3 ubiquitin transferase n=1 Tax=Actinia tenebrosa TaxID=6105 RepID=A0A6P8HWK5_ACTTE) HSP 1 Score: 63.2 bits (152), Expect = 1.630e-10 Identity = 23/38 (60.53%), Postives = 28/38 (73.68%), Query Frame = 1 Query: 4 VKRCPSCSVWIEKDGGCSHMSCSACRGEFCWRCRSRWS 117 V+RCP C IEKDGGC HM+C+ CRG+FCW C W+ Sbjct: 505 VRRCPKCKYPIEKDGGCQHMTCAKCRGDFCWICLGVWN 542
BLAST of mRNA_P-wetherbeei_contig9760.1.1 vs. uniprot
Match: A0A3Q2CPR7_CYPVA (RBR-type E3 ubiquitin transferase n=2 Tax=Cyprinodon variegatus TaxID=28743 RepID=A0A3Q2CPR7_CYPVA) HSP 1 Score: 58.5 bits (140), Expect = 2.330e-10 Identity = 21/38 (55.26%), Postives = 27/38 (71.05%), Query Frame = 1 Query: 4 VKRCPSCSVWIEKDGGCSHMSCSACRGEFCWRCRSRWS 117 K+CPSC V +E++GGC HM CS CR E+CW C W+ Sbjct: 24 TKKCPSCLVPVERNGGCMHMQCSVCRAEWCWLCGVLWN 61
BLAST of mRNA_P-wetherbeei_contig9760.1.1 vs. uniprot
Match: A0A0J1BCM2_9TREE (RBR-type E3 ubiquitin transferase n=1 Tax=Cutaneotrichosporon oleaginosum TaxID=879819 RepID=A0A0J1BCM2_9TREE) HSP 1 Score: 62.4 bits (150), Expect = 3.050e-10 Identity = 23/38 (60.53%), Postives = 26/38 (68.42%), Query Frame = 1 Query: 4 VKRCPSCSVWIEKDGGCSHMSCSACRGEFCWRCRSRWS 117 K CP C IEK+GGC+HM+C CRGEFCW C WS Sbjct: 294 TKECPKCQSTIEKNGGCNHMTCKKCRGEFCWVCMGPWS 331
BLAST of mRNA_P-wetherbeei_contig9760.1.1 vs. uniprot
Match: A0A024U130_9STRA (Uncharacterized protein n=1 Tax=Aphanomyces invadans TaxID=157072 RepID=A0A024U130_9STRA) HSP 1 Score: 61.6 bits (148), Expect = 5.690e-10 Identity = 22/37 (59.46%), Postives = 28/37 (75.68%), Query Frame = 1 Query: 4 VKRCPSCSVWIEKDGGCSHMSCSACRGEFCWRCRSRW 114 VK CP C +IEK+GGC+HM+C+ CR EFCW C +W Sbjct: 377 VKSCPRCKRFIEKNGGCNHMTCTQCRFEFCWSCMDKW 413
BLAST of mRNA_P-wetherbeei_contig9760.1.1 vs. uniprot
Match: UPI001C05E3F4 (E3 ubiquitin-protein ligase parkin n=1 Tax=Melanotaenia boesemani TaxID=1250792 RepID=UPI001C05E3F4) HSP 1 Score: 61.6 bits (148), Expect = 5.700e-10 Identity = 22/38 (57.89%), Postives = 28/38 (73.68%), Query Frame = 1 Query: 4 VKRCPSCSVWIEKDGGCSHMSCSACRGEFCWRCRSRWS 117 KRCP CSV +E++GGC HM CS C+ E+CW CR W+ Sbjct: 409 TKRCPQCSVPVERNGGCMHMQCSLCKAEWCWLCRVPWN 446 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig9760.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig9760.1.1 >prot_P-wetherbeei_contig9760.1.1 ID=prot_P-wetherbeei_contig9760.1.1|Name=mRNA_P-wetherbeei_contig9760.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=41bp GVKRCPSCSVWIEKDGGCSHMSCSACRGEFCWRCRSRWSGGback to top mRNA from alignment at P-wetherbeei_contig9760:355..477- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig9760.1.1 ID=mRNA_P-wetherbeei_contig9760.1.1|Name=mRNA_P-wetherbeei_contig9760.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=123bp|location=Sequence derived from alignment at P-wetherbeei_contig9760:355..477- (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig9760:355..477- >mRNA_P-wetherbeei_contig9760.1.1 ID=mRNA_P-wetherbeei_contig9760.1.1|Name=mRNA_P-wetherbeei_contig9760.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=123bp|location=Sequence derived from alignment at P-wetherbeei_contig9760:355..477- (Phaeothamnion wetherbeei SAG_119_79)back to top |