mRNA_P-wetherbeei_contig9732.1.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig9732.1.1 vs. uniprot
Match: A0A2V0NY40_9CHLO (Uncharacterized protein n=1 Tax=Raphidocelis subcapitata TaxID=307507 RepID=A0A2V0NY40_9CHLO) HSP 1 Score: 58.2 bits (139), Expect = 4.530e-6 Identity = 35/71 (49.30%), Postives = 40/71 (56.34%), Query Frame = 1 Query: 1 AAGAGRLEVLQWGKRQGFRFSKWSCADAAAGGHLDVLRWLRGEECGCEWGEETTWMAAMNGHLAVVQWARA 213 AA G L VL+W Q CA AAAGG L+ L L GCEW + T AA +GHLAV+QWARA Sbjct: 111 AAFHGDLAVLRWALPQRDDAGTLYCAAAAAGGQLEAL--LCARALGCEWWDSTCAAAARHGHLAVLQWARA 179
BLAST of mRNA_P-wetherbeei_contig9732.1.1 vs. uniprot
Match: A0A2V0PEX5_9CHLO (Uncharacterized protein n=1 Tax=Raphidocelis subcapitata TaxID=307507 RepID=A0A2V0PEX5_9CHLO) HSP 1 Score: 56.6 bits (135), Expect = 1.530e-5 Identity = 34/71 (47.89%), Postives = 39/71 (54.93%), Query Frame = 1 Query: 1 AAGAGRLEVLQWGKRQGFRFSKWSCADAAAGGHLDVLRWLRGEECGCEWGEETTWMAAMNGHLAVVQWARA 213 AA G L VL+W Q C AAAGG L+ L+ R GC WG +T AA GHLAV+QWARA Sbjct: 97 AAFHGDLAVLRWALPQVDNAHTLCCGAAAAGGQLEALQCAR--TLGCAWGAQTCRAAARCGHLAVLQWARA 165
BLAST of mRNA_P-wetherbeei_contig9732.1.1 vs. uniprot
Match: A0A2V0P1G7_9CHLO (Uncharacterized protein n=1 Tax=Raphidocelis subcapitata TaxID=307507 RepID=A0A2V0P1G7_9CHLO) HSP 1 Score: 55.8 bits (133), Expect = 2.260e-5 Identity = 34/71 (47.89%), Postives = 40/71 (56.34%), Query Frame = 1 Query: 1 AAGAGRLEVLQWGKRQGFRFSKWSCADAAAGGHLDVLRWLRGEECGCEWGEETTWMAAMNGHLAVVQWARA 213 AA G L VL+W Q C AAAGG L+ L+ R GCEW E T +AA GHLAV++WARA Sbjct: 110 AAFHGDLAVLRWALPQLDGDGTLYCNAAAAGGQLEALQCAR--TLGCEWDEATCAVAAQGGHLAVLRWARA 178
BLAST of mRNA_P-wetherbeei_contig9732.1.1 vs. uniprot
Match: A0A2V0NYS1_9CHLO (Uncharacterized protein n=1 Tax=Raphidocelis subcapitata TaxID=307507 RepID=A0A2V0NYS1_9CHLO) HSP 1 Score: 55.1 bits (131), Expect = 3.130e-5 Identity = 34/71 (47.89%), Postives = 39/71 (54.93%), Query Frame = 1 Query: 1 AAGAGRLEVLQWGKRQGFRFSKWSCADAAAGGHLDVLRWLRGEECGCEWGEETTWMAAMNGHLAVVQWARA 213 AA G L L W + + C AAAGG L+ LR R GC WGE+T AA GHLAV+QWARA Sbjct: 96 AAFHGDLAALGWTLPRLDDSATLYCEAAAAGGQLEALRCARA--LGCAWGEDTCSFAAGGGHLAVLQWARA 164
BLAST of mRNA_P-wetherbeei_contig9732.1.1 vs. uniprot
Match: A0A7S3FLX4_9CHLO (Hypothetical protein (Fragment) n=1 Tax=Chloropicon roscoffensis TaxID=1461544 RepID=A0A7S3FLX4_9CHLO) HSP 1 Score: 52.0 bits (123), Expect = 3.580e-5 Identity = 22/53 (41.51%), Postives = 33/53 (62.26%), Query Frame = 1 Query: 1 AAGAGRLEVLQWGKRQGFRFSKWSCADAAAGGHLDVLRWLRGEECGCEWGEET 159 A G +EV ++ + +G+ F +C AA GGHL+ L+WLRG++ C W E T Sbjct: 32 AGHGGSVEVFEYIRGKGYGFDVMACYMAALGGHLEALKWLRGQDPPCRWDEHT 84 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig9732.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 5
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig9732.1.1 >prot_P-wetherbeei_contig9732.1.1 ID=prot_P-wetherbeei_contig9732.1.1|Name=mRNA_P-wetherbeei_contig9732.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=256bp AAGAGRLEVLQWGKRQGFRFSKWSCADAAAGGHLDVLRWLRGEECGCEWGback to top mRNA from alignment at P-wetherbeei_contig9732:1539..2306- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig9732.1.1 ID=mRNA_P-wetherbeei_contig9732.1.1|Name=mRNA_P-wetherbeei_contig9732.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=768bp|location=Sequence derived from alignment at P-wetherbeei_contig9732:1539..2306- (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig9732:1539..2306- >mRNA_P-wetherbeei_contig9732.1.1 ID=mRNA_P-wetherbeei_contig9732.1.1|Name=mRNA_P-wetherbeei_contig9732.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=768bp|location=Sequence derived from alignment at P-wetherbeei_contig9732:1539..2306- (Phaeothamnion wetherbeei SAG_119_79)back to top |