mRNA_P-wetherbeei_contig12905.1.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig12905.1.1 vs. uniprot
Match: K3X845_GLOUD (RING-type E3 ubiquitin transferase n=1 Tax=Globisporangium ultimum (strain ATCC 200006 / CBS 805.95 / DAOM BR144) TaxID=431595 RepID=K3X845_GLOUD) HSP 1 Score: 81.6 bits (200), Expect = 4.840e-16 Identity = 39/71 (54.93%), Postives = 52/71 (73.24%), Query Frame = 1 Query: 1 TDPSNVMVL-TNAMSQELTCPICLDVLKDTHVVKECMHRFCGVCITKALREGHF-CPACRVHVSTRRSLRR 207 TDPS L ++ ELTCPICL ++++T VV EC+HRFCG CI K LR G+ CP+CR+H+ ++RSLRR Sbjct: 62 TDPSATKTLPVRVLNAELTCPICLGIIRNTMVVMECLHRFCGECIQKCLRLGNKECPSCRIHIPSKRSLRR 132
BLAST of mRNA_P-wetherbeei_contig12905.1.1 vs. uniprot
Match: A0A2P4XLU4_9STRA (RING-type E3 ubiquitin transferase n=1 Tax=Phytophthora palmivora var. palmivora TaxID=611791 RepID=A0A2P4XLU4_9STRA) HSP 1 Score: 79.3 bits (194), Expect = 2.950e-15 Identity = 36/70 (51.43%), Postives = 53/70 (75.71%), Query Frame = 1 Query: 1 TDPSNVMVLT-NAMSQELTCPICLDVLKDTHVVKECMHRFCGVCITKALREGHF-CPACRVHVSTRRSLR 204 TDP+ L+ ++ +LTCPICL +LK+T VV EC+HRFCG CI+ A+R+ + CP+CR+H+ ++RSLR Sbjct: 59 TDPNATKTLSVRQLNADLTCPICLSILKETMVVMECLHRFCGECISTAIRQSNRECPSCRIHIPSKRSLR 128
BLAST of mRNA_P-wetherbeei_contig12905.1.1 vs. uniprot
Match: A0A662X7H6_9STRA (RING-type E3 ubiquitin transferase n=1 Tax=Nothophytophthora sp. Chile5 TaxID=2483409 RepID=A0A662X7H6_9STRA) HSP 1 Score: 78.6 bits (192), Expect = 4.820e-15 Identity = 35/70 (50.00%), Postives = 51/70 (72.86%), Query Frame = 1 Query: 1 TDPSNVMVL-TNAMSQELTCPICLDVLKDTHVVKECMHRFCGVCITKALREGHF-CPACRVHVSTRRSLR 204 TDP+ L ++ +LTCPICL ++K+T VV EC+HRFCG CI+ A+R+ CP+CR+H+ ++RSLR Sbjct: 61 TDPNATKTLPVRVLNADLTCPICLGIIKETMVVMECLHRFCGACISTAIRQNQRQCPSCRIHIPSKRSLR 130
BLAST of mRNA_P-wetherbeei_contig12905.1.1 vs. uniprot
Match: H3H116_PHYRM (RING-type E3 ubiquitin transferase n=1 Tax=Phytophthora ramorum TaxID=164328 RepID=H3H116_PHYRM) HSP 1 Score: 78.6 bits (192), Expect = 5.850e-15 Identity = 36/70 (51.43%), Postives = 51/70 (72.86%), Query Frame = 1 Query: 1 TDPSNVMVLT-NAMSQELTCPICLDVLKDTHVVKECMHRFCGVCITKALREG-HFCPACRVHVSTRRSLR 204 TDPS L+ ++ +LTCPICL ++K+T VV EC+HRFCG CI+ A+R CP+CR+H+ ++RSLR Sbjct: 57 TDPSATRTLSVRVLNADLTCPICLGIIKETMVVMECLHRFCGECISTAIRHSKRECPSCRIHIPSKRSLR 126
BLAST of mRNA_P-wetherbeei_contig12905.1.1 vs. uniprot
Match: A0A662XZT3_9STRA (RING-type E3 ubiquitin transferase n=1 Tax=Nothophytophthora sp. Chile5 TaxID=2483409 RepID=A0A662XZT3_9STRA) HSP 1 Score: 78.6 bits (192), Expect = 7.230e-15 Identity = 35/70 (50.00%), Postives = 51/70 (72.86%), Query Frame = 1 Query: 1 TDPSNVMVL-TNAMSQELTCPICLDVLKDTHVVKECMHRFCGVCITKALREGHF-CPACRVHVSTRRSLR 204 TDP+ L ++ +LTCPICL ++K+T VV EC+HRFCG CI+ A+R+ CP+CR+H+ ++RSLR Sbjct: 210 TDPNATKTLPVRVLNADLTCPICLGIIKETMVVMECLHRFCGACISTAIRQNQRQCPSCRIHIPSKRSLR 279
BLAST of mRNA_P-wetherbeei_contig12905.1.1 vs. uniprot
Match: A0A5D6XKN8_9STRA (RING-type E3 ubiquitin transferase n=1 Tax=Pythium brassicum TaxID=1485010 RepID=A0A5D6XKN8_9STRA) HSP 1 Score: 78.2 bits (191), Expect = 8.290e-15 Identity = 38/71 (53.52%), Postives = 48/71 (67.61%), Query Frame = 1 Query: 1 TDPSNVMVL-TNAMSQELTCPICLDVLKDTHVVKECMHRFCGVCITKALR-EGHFCPACRVHVSTRRSLRR 207 TDP L ++ ELTCPICL V++ T VV EC+HRFCG CI K LR CP+CR+H+ ++RSLRR Sbjct: 63 TDPRATKTLPVRVLNAELTCPICLGVIRSTMVVMECLHRFCGECIQKCLRLSNRECPSCRIHIPSKRSLRR 133
BLAST of mRNA_P-wetherbeei_contig12905.1.1 vs. uniprot
Match: A0A0W8CA54_PHYNI (RING-type E3 ubiquitin transferase n=19 Tax=Phytophthora TaxID=4783 RepID=A0A0W8CA54_PHYNI) HSP 1 Score: 77.8 bits (190), Expect = 1.060e-14 Identity = 35/70 (50.00%), Postives = 52/70 (74.29%), Query Frame = 1 Query: 1 TDPSNVMVLT-NAMSQELTCPICLDVLKDTHVVKECMHRFCGVCITKALREG-HFCPACRVHVSTRRSLR 204 TDP+ L+ ++ +LTCPICL ++K+T VV EC+HRFCG CI+ A+R+ CP+CR+H+ ++RSLR Sbjct: 58 TDPNATKTLSIRQLNADLTCPICLGIIKETMVVMECLHRFCGECISTAIRQSKRECPSCRIHIPSKRSLR 127
BLAST of mRNA_P-wetherbeei_contig12905.1.1 vs. uniprot
Match: A0A225VR01_9STRA (RING-type E3 ubiquitin transferase n=1 Tax=Phytophthora megakarya TaxID=4795 RepID=A0A225VR01_9STRA) HSP 1 Score: 77.4 bits (189), Expect = 1.480e-14 Identity = 35/70 (50.00%), Postives = 52/70 (74.29%), Query Frame = 1 Query: 1 TDPSNVMVLT-NAMSQELTCPICLDVLKDTHVVKECMHRFCGVCITKALREG-HFCPACRVHVSTRRSLR 204 TDP+ L+ ++ +LTCPICL ++K+T VV EC+HRFCG CI+ A+R+ CP+CR+H+ ++RSLR Sbjct: 57 TDPNATKTLSVRHLNADLTCPICLGIIKETMVVMECLHRFCGECISTAIRQSKRECPSCRIHIPSKRSLR 126
BLAST of mRNA_P-wetherbeei_contig12905.1.1 vs. uniprot
Match: G4ZGG9_PHYSP (RING-type E3 ubiquitin transferase n=1 Tax=Phytophthora sojae (strain P6497) TaxID=1094619 RepID=G4ZGG9_PHYSP) HSP 1 Score: 77.4 bits (189), Expect = 1.560e-14 Identity = 35/70 (50.00%), Postives = 52/70 (74.29%), Query Frame = 1 Query: 1 TDPSNVMVLT-NAMSQELTCPICLDVLKDTHVVKECMHRFCGVCITKALREG-HFCPACRVHVSTRRSLR 204 TDP+ L+ ++ +LTCPICL ++K+T VV EC+HRFCG CI+ A+R+ CP+CR+H+ ++RSLR Sbjct: 63 TDPAATKTLSVRQLNADLTCPICLGIIKETMVVMECLHRFCGDCISTAIRQSKRECPSCRIHIPSKRSLR 132
BLAST of mRNA_P-wetherbeei_contig12905.1.1 vs. uniprot
Match: A0A484E6Z9_BRELC (RING-type E3 ubiquitin transferase n=1 Tax=Bremia lactucae TaxID=4779 RepID=A0A484E6Z9_BRELC) HSP 1 Score: 77.0 bits (188), Expect = 2.070e-14 Identity = 35/70 (50.00%), Postives = 51/70 (72.86%), Query Frame = 1 Query: 1 TDPSNVMVLT-NAMSQELTCPICLDVLKDTHVVKECMHRFCGVCITKALREG-HFCPACRVHVSTRRSLR 204 TDP+ L+ ++ +LTCPICL ++K T VV EC+HRFCG CI+ A+R+ CP+CR+H+ ++RSLR Sbjct: 58 TDPNATKTLSVRQLNADLTCPICLGIIKQTMVVMECLHRFCGECISTAIRQSKRECPSCRIHIPSKRSLR 127 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig12905.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig12905.1.1 >prot_P-wetherbeei_contig12905.1.1 ID=prot_P-wetherbeei_contig12905.1.1|Name=mRNA_P-wetherbeei_contig12905.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=95bp MVLTNAMSQELTCPICLDVLKDTHVVKECMHRFCGVCITKALREGHFCPAback to top mRNA from alignment at P-wetherbeei_contig12905:389..1072+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig12905.1.1 ID=mRNA_P-wetherbeei_contig12905.1.1|Name=mRNA_P-wetherbeei_contig12905.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=684bp|location=Sequence derived from alignment at P-wetherbeei_contig12905:389..1072+ (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig12905:389..1072+ >mRNA_P-wetherbeei_contig12905.1.1 ID=mRNA_P-wetherbeei_contig12905.1.1|Name=mRNA_P-wetherbeei_contig12905.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=285bp|location=Sequence derived from alignment at P-wetherbeei_contig12905:389..1072+ (Phaeothamnion wetherbeei SAG_119_79)back to top |