mRNA_P-wetherbeei_contig1227.4.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig1227.4.1 vs. uniprot
Match: K3Z744_SETIT (Uncharacterized protein n=7 Tax=Paniceae TaxID=147428 RepID=K3Z744_SETIT) HSP 1 Score: 76.3 bits (186), Expect = 5.570e-11 Identity = 37/67 (55.22%), Postives = 46/67 (68.66%), Query Frame = 2 Query: 125 GGGAIRLK-RHKCGTCGMAFDKPAKLKRHVDSVHLKVRPFACERPGCGLAYARKDHLVRHMESHNGR 322 GGGA R + H C CGM+F KPA LK+H+ S H RPFAC GC L+Y+RKDHL RH+ +H G+ Sbjct: 69 GGGASRKEVTHDCKECGMSFKKPAHLKQHMQS-HSLERPFACHIDGCPLSYSRKDHLNRHLLTHQGK 134
BLAST of mRNA_P-wetherbeei_contig1227.4.1 vs. uniprot
Match: A0A835KBF6_9POAL (Uncharacterized protein n=2 Tax=Digitaria exilis TaxID=1010633 RepID=A0A835KBF6_9POAL) HSP 1 Score: 73.2 bits (178), Expect = 5.330e-10 Identity = 35/68 (51.47%), Postives = 44/68 (64.71%), Query Frame = 2 Query: 125 GGGAIRLKR--HKCGTCGMAFDKPAKLKRHVDSVHLKVRPFACERPGCGLAYARKDHLVRHMESHNGR 322 GG + K H+C CGM+F KPA LK+H+ S H RPFAC GC L Y+RKDHL RH+ +H G+ Sbjct: 62 GGDGVSRKEVSHECEKCGMSFKKPAHLKQHMQS-HSLERPFACHVEGCPLRYSRKDHLNRHLLTHQGK 128
BLAST of mRNA_P-wetherbeei_contig1227.4.1 vs. uniprot
Match: A0A835QR79_VANPL (Uncharacterized protein n=2 Tax=Vanilla planifolia TaxID=51239 RepID=A0A835QR79_VANPL) HSP 1 Score: 72.4 bits (176), Expect = 1.080e-9 Identity = 31/57 (54.39%), Postives = 39/57 (68.42%), Query Frame = 2 Query: 1397 PSVVCTVAGCGKLFTMRKNLLKHIKVIHEKERPFACRYAVCARPFAYKHVRDKHEKT 1567 P + C+ GC ++ + NL KH+K IHEK RPFACR + C + F YKHVRD HEKT Sbjct: 258 PKLKCSFEGCEHTYSRKSNLKKHVKAIHEKLRPFACRTSGCHQKFHYKHVRDAHEKT 314
BLAST of mRNA_P-wetherbeei_contig1227.4.1 vs. uniprot
Match: UPI0011D1D7CA (transcription factor IIIA-like n=4 Tax=Syzygium oleosum TaxID=219896 RepID=UPI0011D1D7CA) HSP 1 Score: 70.1 bits (170), Expect = 2.060e-9 Identity = 28/53 (52.83%), Postives = 37/53 (69.81%), Query Frame = 2 Query: 1409 CTVAGCGKLFTMRKNLLKHIKVIHEKERPFACRYAVCARPFAYKHVRDKHEKT 1567 C V GC ++F+ + NL +H+K +H + RPF C Y C + FAYKHVRD HEKT Sbjct: 171 CDVEGCLRIFSTKSNLRQHVKAVHLEVRPFVCSYKDCGKKFAYKHVRDHHEKT 223
BLAST of mRNA_P-wetherbeei_contig1227.4.1 vs. uniprot
Match: UPI0011D2B336 (transcription factor IIIA-like n=1 Tax=Syzygium oleosum TaxID=219896 RepID=UPI0011D2B336) HSP 1 Score: 70.1 bits (170), Expect = 6.330e-9 Identity = 28/53 (52.83%), Postives = 37/53 (69.81%), Query Frame = 2 Query: 1409 CTVAGCGKLFTMRKNLLKHIKVIHEKERPFACRYAVCARPFAYKHVRDKHEKT 1567 C V GC ++F+ + NL +H+K +H + RPF C Y C + FAYKHVRD HEKT Sbjct: 257 CDVEGCLRIFSTKSNLRQHVKAVHLEVRPFVCSYKDCGKKFAYKHVRDHHEKT 309
BLAST of mRNA_P-wetherbeei_contig1227.4.1 vs. uniprot
Match: UPI000B776670 (transcription factor IIIA-like isoform X2 n=1 Tax=Chenopodium quinoa TaxID=63459 RepID=UPI000B776670) HSP 1 Score: 69.3 bits (168), Expect = 6.410e-9 Identity = 31/71 (43.66%), Postives = 44/71 (61.97%), Query Frame = 2 Query: 1388 QQLPSVV-CTVAGCGKLFTMRKNLLKHIKVIHEKERPFACRYAVCARPFAYKHVRDKHEKT-----IHGGL 1582 + LP+++ CT GC FT + N+ +H+K +H K RPF C + C FA+KHVRD HEK+ +HG L Sbjct: 194 EHLPTILKCTFEGCDHSFTTKSNMQQHVKAVHLKLRPFVCSFTGCGMRFAFKHVRDNHEKSARHVYVHGDL 264
BLAST of mRNA_P-wetherbeei_contig1227.4.1 vs. uniprot
Match: A0A059CTW7_EUCGR (Uncharacterized protein n=2 Tax=Eucalyptus grandis TaxID=71139 RepID=A0A059CTW7_EUCGR) HSP 1 Score: 69.7 bits (169), Expect = 6.500e-9 Identity = 29/53 (54.72%), Postives = 37/53 (69.81%), Query Frame = 2 Query: 1409 CTVAGCGKLFTMRKNLLKHIKVIHEKERPFACRYAVCARPFAYKHVRDKHEKT 1567 C V GC +F+ + NL +H+K +H + RPF C Y C + FAYKHVRDKHEKT Sbjct: 257 CDVEGCLCVFSTKSNLRQHVKAVHLEVRPFVCGYKDCGKKFAYKHVRDKHEKT 309
BLAST of mRNA_P-wetherbeei_contig1227.4.1 vs. uniprot
Match: W9RZD5_9ROSA (Transcription factor IIIA n=1 Tax=Morus notabilis TaxID=981085 RepID=W9RZD5_9ROSA) HSP 1 Score: 69.7 bits (169), Expect = 6.740e-9 Identity = 29/56 (51.79%), Postives = 37/56 (66.07%), Query Frame = 2 Query: 1400 SVVCTVAGCGKLFTMRKNLLKHIKVIHEKERPFACRYAVCARPFAYKHVRDKHEKT 1567 S+ C GC F+ + NL +H+K H K++PFAC +A C FAYKHVRD HEKT Sbjct: 245 SIKCNFKGCDHTFSTKSNLNQHVKAAHLKQKPFACGFAGCGMRFAYKHVRDNHEKT 300
BLAST of mRNA_P-wetherbeei_contig1227.4.1 vs. uniprot
Match: A0A0K9RZG0_SPIOL (C2H2-type domain-containing protein n=4 Tax=Spinacia oleracea TaxID=3562 RepID=A0A0K9RZG0_SPIOL) HSP 1 Score: 66.2 bits (160), Expect = 6.840e-9 Identity = 31/71 (43.66%), Postives = 43/71 (60.56%), Query Frame = 2 Query: 1388 QQLPSVV-CTVAGCGKLFTMRKNLLKHIKVIHEKERPFACRYAVCARPFAYKHVRDKHEKT-----IHGGL 1582 + LP+V+ C+ GC FT + N+ +H+K +H + RPF C C FA+KHVRD HEKT +HG L Sbjct: 44 EHLPTVLKCSFEGCDHSFTTKSNMQQHVKAVHLQLRPFICSIPGCGMKFAFKHVRDNHEKTGRHVHVHGDL 114
BLAST of mRNA_P-wetherbeei_contig1227.4.1 vs. uniprot
Match: A0A803LT92_CHEQI (Uncharacterized protein n=3 Tax=Chenopodium quinoa TaxID=63459 RepID=A0A803LT92_CHEQI) HSP 1 Score: 69.3 bits (168), Expect = 9.460e-9 Identity = 31/71 (43.66%), Postives = 44/71 (61.97%), Query Frame = 2 Query: 1388 QQLPSVV-CTVAGCGKLFTMRKNLLKHIKVIHEKERPFACRYAVCARPFAYKHVRDKHEKT-----IHGGL 1582 + LP+++ CT GC FT + N+ +H+K +H K RPF C + C FA+KHVRD HEK+ +HG L Sbjct: 244 EHLPTILKCTFEGCDHSFTTKSNMQQHVKAVHLKLRPFVCSFTGCGMRFAFKHVRDNHEKSARHVYVHGDL 314 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig1227.4.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig1227.4.1 >prot_P-wetherbeei_contig1227.4.1 ID=prot_P-wetherbeei_contig1227.4.1|Name=mRNA_P-wetherbeei_contig1227.4.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=509bp MAFDKPAKLKRHVDSVHLKVRPFACERPGCGLAYARKDHLVRHMESHNGRback to top mRNA from alignment at P-wetherbeei_contig1227:4799..7622+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig1227.4.1 ID=mRNA_P-wetherbeei_contig1227.4.1|Name=mRNA_P-wetherbeei_contig1227.4.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=2824bp|location=Sequence derived from alignment at P-wetherbeei_contig1227:4799..7622+ (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig1227:4799..7622+ >mRNA_P-wetherbeei_contig1227.4.1 ID=mRNA_P-wetherbeei_contig1227.4.1|Name=mRNA_P-wetherbeei_contig1227.4.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=1527bp|location=Sequence derived from alignment at P-wetherbeei_contig1227:4799..7622+ (Phaeothamnion wetherbeei SAG_119_79)back to top |