mRNA_P-wetherbeei_contig1226.2.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig1226.2.1 vs. uniprot
Match: D8LRV6_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LRV6_ECTSI) HSP 1 Score: 62.4 bits (150), Expect = 7.150e-9 Identity = 27/54 (50.00%), Postives = 43/54 (79.63%), Query Frame = 2 Query: 38 ASFATMDADYLKRTVGDPLSEALARMVVAQPTDAVGYIGDYLLNYVAQRKMEIR 199 A+ + MDA++LKRTVG+PLS+AL +VVAQP D + +IG+ LL+++ +R+ E + Sbjct: 7 AADSAMDAEFLKRTVGEPLSDALTALVVAQPADPIEFIGEALLDFIKRREAEAK 60
BLAST of mRNA_P-wetherbeei_contig1226.2.1 vs. uniprot
Match: A0A1V9YYG1_9STRA (Flagella associated protein n=1 Tax=Achlya hypogyna TaxID=1202772 RepID=A0A1V9YYG1_9STRA) HSP 1 Score: 56.2 bits (134), Expect = 1.040e-6 Identity = 26/44 (59.09%), Postives = 32/44 (72.73%), Query Frame = 2 Query: 56 DADYLKRTVGDPLSEALARMVVAQPTDAVGYIGDYLLNYVAQRK 187 D YLK TVG+PLSEALA++ + QP D + Y+G YLL YVA K Sbjct: 10 DFVYLKTTVGNPLSEALAQLALDQPEDPIEYVGKYLLKYVANEK 53 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig1226.2.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig1226.2.1 >prot_P-wetherbeei_contig1226.2.1 ID=prot_P-wetherbeei_contig1226.2.1|Name=mRNA_P-wetherbeei_contig1226.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=106bp MDADYLKRTVGDPLSEALARMVVAQPTDAVGYIGDYLLNYVAQRKMEIRLback to top mRNA from alignment at P-wetherbeei_contig1226:2770..3565+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig1226.2.1 ID=mRNA_P-wetherbeei_contig1226.2.1|Name=mRNA_P-wetherbeei_contig1226.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=796bp|location=Sequence derived from alignment at P-wetherbeei_contig1226:2770..3565+ (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig1226:2770..3565+ >mRNA_P-wetherbeei_contig1226.2.1 ID=mRNA_P-wetherbeei_contig1226.2.1|Name=mRNA_P-wetherbeei_contig1226.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=318bp|location=Sequence derived from alignment at P-wetherbeei_contig1226:2770..3565+ (Phaeothamnion wetherbeei SAG_119_79)back to top |