mRNA_P-wetherbeei_contig11985.1.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig11985.1.1 vs. uniprot
Match: A0A836CJ32_9STRA (Soluble NSF attachment protein receptor n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836CJ32_9STRA) HSP 1 Score: 100 bits (248), Expect = 1.740e-24 Identity = 50/69 (72.46%), Postives = 57/69 (82.61%), Query Frame = 1 Query: 7 EITSELGRNREKITAVHDKVREVSVMTGSARRLVHSMSKREVQHKFILWGLAFILLGAVALVIYFAASK 213 EIT+ELGRNRE I + H KVREVS MT +ARRLVH+MSKREVQ +FILWG+A +LL AV LVIYFA K Sbjct: 157 EITTELGRNRETIQSAHGKVREVSAMTANARRLVHNMSKREVQQRFILWGIALLLLLAVILVIYFAVKK 225
BLAST of mRNA_P-wetherbeei_contig11985.1.1 vs. uniprot
Match: A0A7S2V424_9STRA (Hypothetical protein n=1 Tax=Fibrocapsa japonica TaxID=94617 RepID=A0A7S2V424_9STRA) HSP 1 Score: 94.7 bits (234), Expect = 2.750e-22 Identity = 45/67 (67.16%), Postives = 57/67 (85.07%), Query Frame = 1 Query: 1 ALEITSELGRNREKITAVHDKVREVSVMTGSARRLVHSMSKREVQHKFILWGLAFILLGAVALVIYF 201 ALEIT ELGRNREKI +VH KVREV MT +ARR++HSM+KREVQ KFI++G+A +LL A+ +VIY+ Sbjct: 169 ALEITQELGRNREKIESVHSKVREVGSMTHTARRIIHSMNKREVQQKFIIYGVALVLLAAICVVIYY 235
BLAST of mRNA_P-wetherbeei_contig11985.1.1 vs. uniprot
Match: D7FI03_ECTSI (Soluble NSF Attachment Protein (SNAP) Receptor (SNARE) n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FI03_ECTSI) HSP 1 Score: 77.0 bits (188), Expect = 1.370e-15 Identity = 39/61 (63.93%), Postives = 50/61 (81.97%), Query Frame = 1 Query: 19 ELGRNREKITAVHDKVREVSVMTGSARRLVHSMSKREVQHKFILWGLAFIL-LGAVALVIY 198 ELGRNREKI VHDKVR+VS MT SARRLVH+M++REVQ + I++G+ +L +GA+A V Y Sbjct: 158 ELGRNREKIGEVHDKVRDVSGMTTSARRLVHNMNRREVQQRCIMYGIGLVLVIGAIAAVYY 218
BLAST of mRNA_P-wetherbeei_contig11985.1.1 vs. uniprot
Match: A0A6U0QSX3_9STRA (Hypothetical protein n=1 Tax=Eucampia antarctica TaxID=49252 RepID=A0A6U0QSX3_9STRA) HSP 1 Score: 72.8 bits (177), Expect = 3.740e-14 Identity = 36/65 (55.38%), Postives = 50/65 (76.92%), Query Frame = 1 Query: 1 ALEITSELGRNREKITAVHDKVREVSVMTGSARRLVHSMSKREVQHKFILWGLAFILLGAVALVI 195 ALEITSELGRNRE I++ H +VR+VS +T ARR+V +MS+REVQ K ++ + FILL + ++I Sbjct: 130 ALEITSELGRNRETISSAHSRVRDVSGLTNQARRIVQNMSRREVQQKLAIYVVCFILLVVLIIMI 194
BLAST of mRNA_P-wetherbeei_contig11985.1.1 vs. uniprot
Match: K0R0D9_THAOC (V-SNARE domain-containing protein n=1 Tax=Thalassiosira oceanica TaxID=159749 RepID=K0R0D9_THAOC) HSP 1 Score: 72.0 bits (175), Expect = 1.210e-13 Identity = 36/66 (54.55%), Postives = 50/66 (75.76%), Query Frame = 1 Query: 1 ALEITSELGRNREKITAVHDKVREVSVMTGSARRLVHSMSKREVQHKFILWGLAFILLGAVALVIY 198 ALEIT ELGR+RE I++ H +VR+V+ MT ARR+V SMS+REVQ K IL+G+A ++ ++IY Sbjct: 158 ALEITEELGRHRETISSAHGRVRQVTGMTNRARRIVQSMSRREVQQKLILYGVAGTIMIVFLMLIY 223
BLAST of mRNA_P-wetherbeei_contig11985.1.1 vs. uniprot
Match: A0A6U3TNS8_9STRA (Hypothetical protein n=1 Tax=Skeletonema marinoi TaxID=267567 RepID=A0A6U3TNS8_9STRA) HSP 1 Score: 71.6 bits (174), Expect = 1.980e-13 Identity = 36/66 (54.55%), Postives = 50/66 (75.76%), Query Frame = 1 Query: 1 ALEITSELGRNREKITAVHDKVREVSVMTGSARRLVHSMSKREVQHKFILWGLAFILLGAVALVIY 198 ALEIT ELGR+RE I++ H +VR+V+ MT ARR+V SMS+REVQ K IL+G+A ++ ++IY Sbjct: 168 ALEITEELGRHRETISSAHGRVRQVTGMTNRARRIVQSMSRREVQQKLILYGVAGTIVLVFLMLIY 233
BLAST of mRNA_P-wetherbeei_contig11985.1.1 vs. uniprot
Match: A0A1Z5KPD8_FISSO (Vesicle transport through interaction with t-SNAREs 1 n=2 Tax=Fistulifera solaris TaxID=1519565 RepID=A0A1Z5KPD8_FISSO) HSP 1 Score: 68.6 bits (166), Expect = 1.690e-12 Identity = 35/66 (53.03%), Postives = 48/66 (72.73%), Query Frame = 1 Query: 1 ALEITSELGRNREKITAVHDKVREVSVMTGSARRLVHSMSKREVQHKFILWGLAFILLGAVALVIY 198 ALEIT ELG NRE + H +VREVS MTG ARR++ SMS+R+VQ K I++G+A L+ A +++ Sbjct: 132 ALEITEELGNNRETLLNAHGRVREVSGMTGRARRILTSMSRRQVQQKMIVYGIAIGLVLAFLFLLW 197
BLAST of mRNA_P-wetherbeei_contig11985.1.1 vs. uniprot
Match: A0A6S8XXA7_9STRA (Hypothetical protein n=1 Tax=Ditylum brightwellii TaxID=49249 RepID=A0A6S8XXA7_9STRA) HSP 1 Score: 68.6 bits (166), Expect = 2.260e-12 Identity = 32/66 (48.48%), Postives = 49/66 (74.24%), Query Frame = 1 Query: 1 ALEITSELGRNREKITAVHDKVREVSVMTGSARRLVHSMSKREVQHKFILWGLAFILLGAVALVIY 198 A+EIT+ELGRNRE I + H +VREVS +T ARR+V +MS+REVQ K +L+ + ++ + ++I+ Sbjct: 153 AMEITTELGRNRETIQSAHGRVREVSGLTNRARRIVQNMSRREVQQKLVLYMVLAVIFIVLVIIIF 218
BLAST of mRNA_P-wetherbeei_contig11985.1.1 vs. uniprot
Match: A0A7S4MHQ9_9STRA (Hypothetical protein n=1 Tax=Odontella aurita TaxID=265563 RepID=A0A7S4MHQ9_9STRA) HSP 1 Score: 65.9 bits (159), Expect = 3.400e-12 Identity = 31/65 (47.69%), Postives = 49/65 (75.38%), Query Frame = 1 Query: 1 ALEITSELGRNREKITAVHDKVREVSVMTGSARRLVHSMSKREVQHKFILWGLAFILLGAVALVI 195 ALEIT ELGRNREKI + H +V++VS +T ARR+V SM++REVQ K ++ ++ +L+ + +++ Sbjct: 48 ALEITEELGRNREKIESAHGRVKDVSGLTNRARRIVQSMNRREVQQKLAMYVVSAMLIVVLIVIL 112
BLAST of mRNA_P-wetherbeei_contig11985.1.1 vs. uniprot
Match: A0A7S3P7W6_9STRA (Hypothetical protein n=1 Tax=Amphora coffeiformis TaxID=265554 RepID=A0A7S3P7W6_9STRA) HSP 1 Score: 67.0 bits (162), Expect = 6.780e-12 Identity = 33/54 (61.11%), Postives = 43/54 (79.63%), Query Frame = 1 Query: 1 ALEITSELGRNREKITAVHDKVREVSVMTGSARRLVHSMSKREVQHKFILWGLA 162 ALEIT ELG+NREK+ + H +VREVS +TG ARR++ SMS+R VQ K IL+ +A Sbjct: 133 ALEITEELGQNREKLISAHGRVREVSGLTGRARRILTSMSQRAVQQKMILYAVA 186 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig11985.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig11985.1.1 >prot_P-wetherbeei_contig11985.1.1 ID=prot_P-wetherbeei_contig11985.1.1|Name=mRNA_P-wetherbeei_contig11985.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=73bp ALEITSELGRNREKITAVHDKVREVSVMTGSARRLVHSMSKREVQHKFILback to top mRNA from alignment at P-wetherbeei_contig11985:947..2057- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig11985.1.1 ID=mRNA_P-wetherbeei_contig11985.1.1|Name=mRNA_P-wetherbeei_contig11985.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=1111bp|location=Sequence derived from alignment at P-wetherbeei_contig11985:947..2057- (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig11985:947..2057- >mRNA_P-wetherbeei_contig11985.1.1 ID=mRNA_P-wetherbeei_contig11985.1.1|Name=mRNA_P-wetherbeei_contig11985.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=219bp|location=Sequence derived from alignment at P-wetherbeei_contig11985:947..2057- (Phaeothamnion wetherbeei SAG_119_79)back to top |