mRNA_P-wetherbeei_contig11959.1.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig11959.1.1 vs. uniprot
Match: A0A6H5KL17_9PHAE (Creatinase_N domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KL17_9PHAE) HSP 1 Score: 102 bits (255), Expect = 1.720e-24 Identity = 47/69 (68.12%), Postives = 57/69 (82.61%), Query Frame = 1 Query: 1 DRLQALRQAMQAAKVDAYIVGSEDPHHSEYVSDHDLRRSWLTSFTGSAGTAVVTASEALVWTDGRYFLQ 207 ++L LR AMQA V AY+V ++D HHSEYV+DHD RR WLT FTGSAGTA+VT ++AL+WTDGRYFLQ Sbjct: 34 EKLSLLRAAMQARGVSAYLVETQDAHHSEYVADHDKRREWLTGFTGSAGTALVTHTKALMWTDGRYFLQ 102
BLAST of mRNA_P-wetherbeei_contig11959.1.1 vs. uniprot
Match: D8LFB1_ECTSI (Creatinase_N domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LFB1_ECTSI) HSP 1 Score: 99.8 bits (247), Expect = 2.430e-24 Identity = 46/69 (66.67%), Postives = 56/69 (81.16%), Query Frame = 1 Query: 1 DRLQALRQAMQAAKVDAYIVGSEDPHHSEYVSDHDLRRSWLTSFTGSAGTAVVTASEALVWTDGRYFLQ 207 ++L LR AMQA V AY+V ++D H SEYV+DHD RR WLT FTGSAGTA+VT ++AL+WTDGRYFLQ Sbjct: 34 EKLSLLRAAMQARGVSAYLVETQDAHQSEYVADHDKRREWLTGFTGSAGTALVTHTKALMWTDGRYFLQ 102
BLAST of mRNA_P-wetherbeei_contig11959.1.1 vs. uniprot
Match: UPI0014255CAD (xaa-Pro aminopeptidase 1-like n=1 Tax=Anneissia japonica TaxID=1529436 RepID=UPI0014255CAD) HSP 1 Score: 89.4 bits (220), Expect = 6.860e-22 Identity = 39/56 (69.64%), Postives = 48/56 (85.71%), Query Frame = 1 Query: 40 KVDAYIVGSEDPHHSEYVSDHDLRRSWLTSFTGSAGTAVVTASEALVWTDGRYFLQ 207 KVDAYI+ SED H SEY++D D RR +++ FTGSAG A+VTA+EAL+WTDGRYFLQ Sbjct: 8 KVDAYIIPSEDAHQSEYIADRDKRRQYISGFTGSAGLAIVTANEALLWTDGRYFLQ 63
BLAST of mRNA_P-wetherbeei_contig11959.1.1 vs. uniprot
Match: A0A3M1Z2Y2_9BACT (Aminopeptidase P family protein (Fragment) n=1 Tax=Bacteroidetes bacterium TaxID=1898104 RepID=A0A3M1Z2Y2_9BACT) HSP 1 Score: 91.7 bits (226), Expect = 1.130e-21 Identity = 41/69 (59.42%), Postives = 52/69 (75.36%), Query Frame = 1 Query: 1 DRLQALRQAMQAAKVDAYIVGSEDPHHSEYVSDHDLRRSWLTSFTGSAGTAVVTASEALVWTDGRYFLQ 207 ++L ALR AM+A +DAYI+ S DPH SEYV+DH R+W++ FTGSAGT +VT EA VW D RYF+Q Sbjct: 5 EKLSALRAAMRAHHIDAYIIPSADPHQSEYVADHWKSRAWISGFTGSAGTVIVTQKEAHVWVDSRYFIQ 73
BLAST of mRNA_P-wetherbeei_contig11959.1.1 vs. uniprot
Match: A0A139AR36_GONPJ (Creatinase/aminopeptidase n=1 Tax=Gonapodya prolifera (strain JEL478) TaxID=1344416 RepID=A0A139AR36_GONPJ) HSP 1 Score: 96.3 bits (238), Expect = 1.220e-21 Identity = 45/68 (66.18%), Postives = 55/68 (80.88%), Query Frame = 1 Query: 4 RLQALRQAMQAAKVDAYIVGSEDPHHSEYVSDHDLRRSWLTSFTGSAGTAVVTASEALVWTDGRYFLQ 207 RL+ LR M+ V AYI+ +EDPH SEY++D D RR+W++ FTGSAGTAVVTAS AL+WTDGRYFLQ Sbjct: 27 RLKHLRDVMKDNAVTAYIIPTEDPHQSEYIADCDKRRAWISGFTGSAGTAVVTASMALLWTDGRYFLQ 94
BLAST of mRNA_P-wetherbeei_contig11959.1.1 vs. uniprot
Match: A0A098S8E6_9BACT (Uncharacterized protein n=1 Tax=Phaeodactylibacter xiamenensis TaxID=1524460 RepID=A0A098S8E6_9BACT) HSP 1 Score: 95.9 bits (237), Expect = 1.650e-21 Identity = 47/67 (70.15%), Postives = 52/67 (77.61%), Query Frame = 1 Query: 7 LQALRQAMQAAKVDAYIVGSEDPHHSEYVSDHDLRRSWLTSFTGSAGTAVVTASEALVWTDGRYFLQ 207 L LRQAMQ +DAYIV S+DPH SEYV+DH R WLT FTGSAGTAVVTAS A +WTD RYF+Q Sbjct: 14 LDRLRQAMQENGLDAYIVPSQDPHQSEYVADHWQARRWLTGFTGSAGTAVVTASTAHLWTDSRYFIQ 80
BLAST of mRNA_P-wetherbeei_contig11959.1.1 vs. uniprot
Match: UPI000711D15A (metallopeptidase M24 family protein n=1 Tax=Blastocystis sp. subtype 4 TaxID=944170 RepID=UPI000711D15A) HSP 1 Score: 94.7 bits (234), Expect = 4.220e-21 Identity = 45/69 (65.22%), Postives = 53/69 (76.81%), Query Frame = 1 Query: 1 DRLQALRQAMQAAKVDAYIVGSEDPHHSEYVSDHDLRRSWLTSFTGSAGTAVVTASEALVWTDGRYFLQ 207 D+L LR M+A K+DAY++ SED H SEYV D RR W++ FTGSAGTAVVT SEAL+WTD RYFLQ Sbjct: 5 DKLAQLRSVMEAKKLDAYVIPSEDQHMSEYVPDCYQRRRWISEFTGSAGTAVVTKSEALLWTDSRYFLQ 73
BLAST of mRNA_P-wetherbeei_contig11959.1.1 vs. uniprot
Match: A0A7S0D2C1_MICPS (Hypothetical protein n=1 Tax=Micromonas pusilla TaxID=38833 RepID=A0A7S0D2C1_MICPS) HSP 1 Score: 94.7 bits (234), Expect = 4.270e-21 Identity = 46/68 (67.65%), Postives = 54/68 (79.41%), Query Frame = 1 Query: 4 RLQALRQAMQAAKVDAYIVGSEDPHHSEYVSDHDLRRSWLTSFTGSAGTAVVTASEALVWTDGRYFLQ 207 +L ALR M AA VDA++V S+DPH SEYV RR+W++ FTGSAGTAVVTA EAL+WTDGRYFLQ Sbjct: 8 KLAALRARMAAASVDAFVVPSQDPHFSEYVPTCFERRAWISGFTGSAGTAVVTAREALLWTDGRYFLQ 75
BLAST of mRNA_P-wetherbeei_contig11959.1.1 vs. uniprot
Match: A0A7X6T259_9CLOT (Aminopeptidase P family protein (Fragment) n=1 Tax=Clostridiaceae bacterium TaxID=1898204 RepID=A0A7X6T259_9CLOT) HSP 1 Score: 88.6 bits (218), Expect = 5.230e-21 Identity = 39/69 (56.52%), Postives = 53/69 (76.81%), Query Frame = 1 Query: 1 DRLQALRQAMQAAKVDAYIVGSEDPHHSEYVSDHDLRRSWLTSFTGSAGTAVVTASEALVWTDGRYFLQ 207 ++L+ALR M+ +DA +G+ DPH SEYV+ + R+WLT FTGSAGTAVVTA +AL+W DGRY++Q Sbjct: 6 EKLEALRAQMKTQAIDACYIGTADPHDSEYVAPYYQARAWLTGFTGSAGTAVVTADQALLWADGRYYIQ 74
BLAST of mRNA_P-wetherbeei_contig11959.1.1 vs. uniprot
Match: UPI0018F28BF7 (aminopeptidase P family N-terminal domain-containing protein n=1 Tax=Petrotoga sp. 9PW.55.5.1 TaxID=1308979 RepID=UPI0018F28BF7) HSP 1 Score: 87.8 bits (216), Expect = 5.530e-21 Identity = 36/69 (52.17%), Postives = 51/69 (73.91%), Query Frame = 1 Query: 1 DRLQALRQAMQAAKVDAYIVGSEDPHHSEYVSDHDLRRSWLTSFTGSAGTAVVTASEALVWTDGRYFLQ 207 +R+ LR+ MQ + AY+V + DPH SEY++D+ R W++ FTGSAGT V+T EA++WTDGRYF+Q Sbjct: 5 ERINRLRELMQKMGITAYVVSTSDPHQSEYIADYYKTRVWISGFTGSAGTVVITQKEAILWTDGRYFIQ 73 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig11959.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig11959.1.1 >prot_P-wetherbeei_contig11959.1.1 ID=prot_P-wetherbeei_contig11959.1.1|Name=mRNA_P-wetherbeei_contig11959.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=60bp MQAAKVDAYIVGSEDPHHSEYVSDHDLRRSWLTSFTGSAGTAVVTASEALback to top mRNA from alignment at P-wetherbeei_contig11959:182..388- Legend: UTRCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig11959.1.1 ID=mRNA_P-wetherbeei_contig11959.1.1|Name=mRNA_P-wetherbeei_contig11959.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=207bp|location=Sequence derived from alignment at P-wetherbeei_contig11959:182..388- (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig11959:182..388- >mRNA_P-wetherbeei_contig11959.1.1 ID=mRNA_P-wetherbeei_contig11959.1.1|Name=mRNA_P-wetherbeei_contig11959.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=180bp|location=Sequence derived from alignment at P-wetherbeei_contig11959:182..388- (Phaeothamnion wetherbeei SAG_119_79)back to top |