mRNA_P-wetherbeei_contig11884.1.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig11884.1.1 vs. uniprot
Match: A0A6H5JVF4_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JVF4_9PHAE) HSP 1 Score: 64.7 bits (156), Expect = 7.400e-10 Identity = 35/77 (45.45%), Postives = 47/77 (61.04%), Query Frame = 1 Query: 1 VRRGDLDAVRHALEAPGGAALEEKSGQFWCTPLLEACRFRQARVATLLLDAGARVDACGGGRYTALHCACDGPADGA 231 +RRG+L V+ L+ G +E G+F T L EACRFR +V LLL+ GA + GGG +T LH AC+GP G+ Sbjct: 22 IRRGNLAEVKRFLDEGGN--VETVGGRFHSTLLTEACRFRATKVIELLLERGAAANVSGGGCWTPLHYACNGPCRGS 96
BLAST of mRNA_P-wetherbeei_contig11884.1.1 vs. uniprot
Match: D7FQI7_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FQI7_ECTSI) HSP 1 Score: 64.3 bits (155), Expect = 1.000e-9 Identity = 35/76 (46.05%), Postives = 46/76 (60.53%), Query Frame = 1 Query: 1 VRRGDLDAVRHALEAPGGAALEEKSGQFWCTPLLEACRFRQARVATLLLDAGARVDACGGGRYTALHCACDGPADG 228 +RRG+L V+ L+ G +E G+F T L EACRFR +V LLL+ GA + GGG +T LH AC+GP G Sbjct: 19 IRRGNLAEVKRFLDEGGN--VETVGGRFHSTLLTEACRFRATKVIDLLLERGAAANVSGGGFWTPLHYACNGPCRG 92 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig11884.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig11884.1.1 >prot_P-wetherbeei_contig11884.1.1 ID=prot_P-wetherbeei_contig11884.1.1|Name=mRNA_P-wetherbeei_contig11884.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=123bp VRRGDLDAVRHALEAPGGAALEEKSGQFWCTPLLEACRFRQARVATLLLDback to top mRNA from alignment at P-wetherbeei_contig11884:161..529- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig11884.1.1 ID=mRNA_P-wetherbeei_contig11884.1.1|Name=mRNA_P-wetherbeei_contig11884.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=369bp|location=Sequence derived from alignment at P-wetherbeei_contig11884:161..529- (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig11884:161..529- >mRNA_P-wetherbeei_contig11884.1.1 ID=mRNA_P-wetherbeei_contig11884.1.1|Name=mRNA_P-wetherbeei_contig11884.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=369bp|location=Sequence derived from alignment at P-wetherbeei_contig11884:161..529- (Phaeothamnion wetherbeei SAG_119_79)back to top |