prot_P-wetherbeei_contig11884.1.1 (polypeptide) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig11884.1.1 vs. uniprot
Match: A0A6H5JVF4_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JVF4_9PHAE) HSP 1 Score: 64.7 bits (156), Expect = 7.400e-10 Identity = 35/77 (45.45%), Postives = 47/77 (61.04%), Query Frame = 0 Query: 1 VRRGDLDAVRHALEAPGGAALEEKSGQFWCTPLLEACRFRQARVATLLLDAGARVDACGGGRYTALHCACDGPADGA 77 +RRG+L V+ L+ G +E G+F T L EACRFR +V LLL+ GA + GGG +T LH AC+GP G+ Sbjct: 22 IRRGNLAEVKRFLDEGGN--VETVGGRFHSTLLTEACRFRATKVIELLLERGAAANVSGGGCWTPLHYACNGPCRGS 96
BLAST of mRNA_P-wetherbeei_contig11884.1.1 vs. uniprot
Match: D7FQI7_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FQI7_ECTSI) HSP 1 Score: 64.3 bits (155), Expect = 1.000e-9 Identity = 35/76 (46.05%), Postives = 46/76 (60.53%), Query Frame = 0 Query: 1 VRRGDLDAVRHALEAPGGAALEEKSGQFWCTPLLEACRFRQARVATLLLDAGARVDACGGGRYTALHCACDGPADG 76 +RRG+L V+ L+ G +E G+F T L EACRFR +V LLL+ GA + GGG +T LH AC+GP G Sbjct: 19 IRRGNLAEVKRFLDEGGN--VETVGGRFHSTLLTEACRFRATKVIDLLLERGAAANVSGGGFWTPLHYACNGPCRG 92 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig11884.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-wetherbeei_contig11884.1.1 ID=prot_P-wetherbeei_contig11884.1.1|Name=mRNA_P-wetherbeei_contig11884.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=123bpback to top |