mRNA_P-wetherbeei_contig11815.1.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig11815.1.1 vs. uniprot
Match: A0A1W0WLA3_HYPDU (Gamma-secretase subunit PEN-2 n=1 Tax=Hypsibius dujardini TaxID=232323 RepID=A0A1W0WLA3_HYPDU) HSP 1 Score: 54.7 bits (130), Expect = 7.580e-6 Identity = 35/88 (39.77%), Postives = 50/88 (56.82%), Query Frame = 2 Query: 26 AQAKKTFILGCVLLLPWLWMMNW-WYFYGKLREGLLDADA-----RKWVMLSLAMSVLSFGALLAWVVVFQTHWHEWGA-AVYGSMVV 268 A + + LG LLP+LW++N W+F G + A+A R +V+ SL V GAL+AW+VVFQTH +WG A Y S ++ Sbjct: 19 ADLSRKYFLGGFALLPFLWLINVVWFFREAFCSGDVSANAEHKRIRGYVVKSLVGCVACTGALIAWIVVFQTHRVQWGPQADYMSFII 106
BLAST of mRNA_P-wetherbeei_contig11815.1.1 vs. uniprot
Match: A0A6A3ZPJ7_9STRA (Uncharacterized protein n=2 Tax=Phytophthora TaxID=4783 RepID=A0A6A3ZPJ7_9STRA) HSP 1 Score: 53.1 bits (126), Expect = 4.080e-5 Identity = 35/98 (35.71%), Postives = 52/98 (53.06%), Query Frame = 2 Query: 8 NMTADAAQAKKTFILGCVLLLPWLWMMNWWYFYGKLREGLLDADARKWVMLSLAMSVLSFGALLAWVVVFQTHWHEWGAAVYGSMV-VVPEHDRT-GW 295 N AD + AKK F LG + LPWL ++N ++ + + +DA WV S +AWV++FQ +W E+G + S+V VVP+ D GW Sbjct: 38 NKEADESVAKKMF-LGGLAFLPWLHLVNVIFYRKQFMDPTIDASVTLWVRRSFMGFCFWTVLFVAWVLLFQLNWKEFG---WQSLVMVVPDQDENPGW 131 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig11815.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig11815.1.1 >prot_P-wetherbeei_contig11815.1.1 ID=prot_P-wetherbeei_contig11815.1.1|Name=mRNA_P-wetherbeei_contig11815.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=184bp MGYAFSGDVCAELRSAVGLGGGLPDALARVGRCCVRIYGGRARARQNWMVback to top mRNA from alignment at P-wetherbeei_contig11815:177..1356+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig11815.1.1 ID=mRNA_P-wetherbeei_contig11815.1.1|Name=mRNA_P-wetherbeei_contig11815.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=1180bp|location=Sequence derived from alignment at P-wetherbeei_contig11815:177..1356+ (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig11815:177..1356+ >mRNA_P-wetherbeei_contig11815.1.1 ID=mRNA_P-wetherbeei_contig11815.1.1|Name=mRNA_P-wetherbeei_contig11815.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=552bp|location=Sequence derived from alignment at P-wetherbeei_contig11815:177..1356+ (Phaeothamnion wetherbeei SAG_119_79)back to top |