mRNA_P-wetherbeei_contig1175.2.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig1175.2.1 vs. uniprot
Match: A0A835YW33_9STRA (Transcription factor Pcc1-domain-containing protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835YW33_9STRA) HSP 1 Score: 80.1 bits (196), Expect = 6.060e-16 Identity = 43/83 (51.81%), Postives = 59/83 (71.08%), Query Frame = 3 Query: 78 PCRCDIEITFNSSRSVAMAKSVLEVDEELQPTRARRTMRI-GEKDDVLLVTFCATEAKQLRVSLSNFYDSAAVVARTLLEFDE 323 P C +E+ + S + A+AK+ +EVDEELQP + RT+ + G K L+ F ATEAK LRVS+S F D+AA+V+RT+LEFDE Sbjct: 5 PYVCKLELRYPSEATAAIAKASMEVDEELQPNKVSRTLELDGNK---LMAQFAATEAKVLRVSVSTFCDTAALVSRTMLEFDE 84
BLAST of mRNA_P-wetherbeei_contig1175.2.1 vs. uniprot
Match: A0A164VLJ9_9AGAM (Transcription factor Pcc1 n=2 Tax=Sistotremastrum TaxID=139133 RepID=A0A164VLJ9_9AGAM) HSP 1 Score: 50.4 bits (119), Expect = 1.230e-5 Identity = 23/78 (29.49%), Postives = 50/78 (64.10%), Query Frame = 3 Query: 90 DIEITFNSSRSVAMAKSVLEVDEELQPTRARRTMRIGEKDDVLLVTFCATEAKQLRVSLSNFYDSAAVVARTLLEFDE 323 D+ + F S+ +A+ V++VD ELQP+ +R +++ +D+VL+ +F + R+++++F ++ +V RT+ EF + Sbjct: 11 DVRVPFVSNEHAEIARRVIDVDPELQPSSVKRHLKV--EDNVLVASFSTLTVRLARLTINSFLENLDLVIRTIGEFGD 86
BLAST of mRNA_P-wetherbeei_contig1175.2.1 vs. uniprot
Match: A0A369HA59_9HYPO (Uncharacterized protein n=1 Tax=Ophiocordyceps camponoti-saundersi (nom. inval.) TaxID=2039874 RepID=A0A369HA59_9HYPO) HSP 1 Score: 49.7 bits (117), Expect = 2.710e-5 Identity = 29/84 (34.52%), Postives = 42/84 (50.00%), Query Frame = 3 Query: 78 PCRCDIEITFNSSRSVAMAKSVLEVDEELQPTRARRTMRIGEKDDVLLVTFCATEAKQLRVSLSNFYDSAAVVARTLLEFDEQI 329 PC + I S R A L VD EL P +RR + D VLLV +CAT + LRV++++F D+ +V + D + Sbjct: 12 PCSLSLRIPLPSVRLAETAFGALRVDAELSPLVSRR---LSVDDAVLLVDYCATTNRMLRVAVNSFLDNVKLVLDVMEHLDVDV 92 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig1175.2.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig1175.2.1 >prot_P-wetherbeei_contig1175.2.1 ID=prot_P-wetherbeei_contig1175.2.1|Name=mRNA_P-wetherbeei_contig1175.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=106bp MNGEQQRLGSAEPLDAEISLPCRCDIEITFNSSRSVAMAKSVLEVDEELQback to top mRNA from alignment at P-wetherbeei_contig1175:3062..3526+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig1175.2.1 ID=mRNA_P-wetherbeei_contig1175.2.1|Name=mRNA_P-wetherbeei_contig1175.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=465bp|location=Sequence derived from alignment at P-wetherbeei_contig1175:3062..3526+ (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig1175:3062..3526+ >mRNA_P-wetherbeei_contig1175.2.1 ID=mRNA_P-wetherbeei_contig1175.2.1|Name=mRNA_P-wetherbeei_contig1175.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=318bp|location=Sequence derived from alignment at P-wetherbeei_contig1175:3062..3526+ (Phaeothamnion wetherbeei SAG_119_79)back to top |