mRNA_P-wetherbeei_contig11732.1.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig11732.1.1 vs. uniprot
Match: A0A3Q0S305_AMPCI (Hydroxylysine kinase, tandem duplicate 1 n=2 Tax=Heroini TaxID=318529 RepID=A0A3Q0S305_AMPCI) HSP 1 Score: 64.7 bits (156), Expect = 3.280e-10 Identity = 36/91 (39.56%), Postives = 55/91 (60.44%), Query Frame = 1 Query: 1 RKRLKPSVAMDQASTIAALLFGLTSASVESLPSYDDNNFKITASSGDIYTLKVQNGVESEDLSLLEAQSALAMRLNANGCTCPAAVATAGG 273 +K KP+++ QAS I L+ LT+++++SLPSYDD NF + S G Y LK+ N +S+++ L+E Q+ L NG A+ TA G Sbjct: 3 QKHAKPNLSHSQASEIVKRLYRLTASAIQSLPSYDDQNFYVAPSEGGEYILKIMNSEDSKNVFLIEVQTYAMSFLQQNGIPAQTALPTASG 93
BLAST of mRNA_P-wetherbeei_contig11732.1.1 vs. uniprot
Match: C1EG93_MICCC (APH domain-containing protein n=1 Tax=Micromonas commoda (strain RCC299 / NOUM17 / CCMP2709) TaxID=296587 RepID=C1EG93_MICCC) HSP 1 Score: 61.6 bits (148), Expect = 4.200e-9 Identity = 33/60 (55.00%), Postives = 40/60 (66.67%), Query Frame = 1 Query: 79 SVESLPSYDDNNFKITASSGDIYTLKVQNGVESEDLSLLEAQSALAMRLNANGCTCPAAV 258 S + L SYDD NF + A+SG YTLKV NGVES++ LL+AQSA+ L A G CP V Sbjct: 42 SAKELNSYDDRNFHVRATSGAQYTLKVHNGVESQNQPLLDAQSAMMRHLTARGVKCPCPV 101
BLAST of mRNA_P-wetherbeei_contig11732.1.1 vs. uniprot
Match: UPI0018EC7B37 (hydroxylysine kinase-like n=1 Tax=Micropterus salmoides TaxID=27706 RepID=UPI0018EC7B37) HSP 1 Score: 58.5 bits (140), Expect = 4.400e-9 Identity = 34/90 (37.78%), Postives = 49/90 (54.44%), Query Frame = 1 Query: 4 KRLKPSVAMDQASTIAALLFGLTSASVESLPSYDDNNFKITASSGDIYTLKVQNGVESEDLSLLEAQSALAMRLNANGCTCPAAVATAGG 273 K KP+++ Q + LF LT + + SLPSYDD NF +TA G Y LK+ N +S++ +L E Q+ L+ NG A+ T G Sbjct: 4 KHSKPNLSQSQVVELVKRLFRLTPSEIRSLPSYDDQNFCVTAVEGGKYVLKIMNSEDSKNPTLFEVQTYAMSFLHQNGLPAQTALPTTSG 93
BLAST of mRNA_P-wetherbeei_contig11732.1.1 vs. uniprot
Match: UPI001E8D0BC7 (hydroxylysine kinase-like isoform X1 n=4 Tax=Micropterus TaxID=27705 RepID=UPI001E8D0BC7) HSP 1 Score: 58.5 bits (140), Expect = 5.150e-8 Identity = 34/90 (37.78%), Postives = 49/90 (54.44%), Query Frame = 1 Query: 4 KRLKPSVAMDQASTIAALLFGLTSASVESLPSYDDNNFKITASSGDIYTLKVQNGVESEDLSLLEAQSALAMRLNANGCTCPAAVATAGG 273 K KP+++ Q + LF LT + + SLPSYDD NF +TA G Y LK+ N +S++ +L E Q+ L+ NG A+ T G Sbjct: 15 KHSKPNLSQSQVVELVKRLFRLTPSEIRSLPSYDDQNFCVTAVEGGKYVLKIMNSEDSKNPTLFEVQTYAMSFLHQNGLPAQTALPTTSG 104
BLAST of mRNA_P-wetherbeei_contig11732.1.1 vs. uniprot
Match: A0A6P7WYM3_9AMPH (hydroxylysine kinase n=1 Tax=Microcaecilia unicolor TaxID=1415580 RepID=A0A6P7WYM3_9AMPH) HSP 1 Score: 58.5 bits (140), Expect = 5.190e-8 Identity = 34/81 (41.98%), Postives = 53/81 (65.43%), Query Frame = 1 Query: 13 KPSVAMDQASTIAALLFGLTSASVESLPSYDDNNFKITA----SSGDI--YTLKVQNGVESEDLSLLEAQSALAMRLNANG 237 KP++ M++A+ I +FGL + ++SLPSYDD NF + A +S DI Y LK+ NG +S++ SL+E Q+++ M L G Sbjct: 11 KPALTMEKAAEIIDAVFGLKVSEIKSLPSYDDQNFLVKALNNETSTDITEYVLKITNGTDSQNASLIELQTSVMMFLKEEG 91
BLAST of mRNA_P-wetherbeei_contig11732.1.1 vs. uniprot
Match: UPI001899B844 (hydroxylysine kinase n=1 Tax=Nematolebias whitei TaxID=451745 RepID=UPI001899B844) HSP 1 Score: 58.2 bits (139), Expect = 6.920e-8 Identity = 34/90 (37.78%), Postives = 48/90 (53.33%), Query Frame = 1 Query: 4 KRLKPSVAMDQASTIAALLFGLTSASVESLPSYDDNNFKITASSGDIYTLKVQNGVESEDLSLLEAQSALAMRLNANGCTCPAAVATAGG 273 K +P + Q S + LF LT ++SLPSYDD NF + GD Y LK+ N +S++ SL+E Q+ ++ NG AV T G Sbjct: 4 KHAQPKFSKIQVSEMVKKLFNLTPREIQSLPSYDDQNFYVAPIEGDEYVLKIMNSEDSKNTSLVEVQTYAMSFVHQNGLPSQTAVPTKSG 93
BLAST of mRNA_P-wetherbeei_contig11732.1.1 vs. uniprot
Match: I3K3N3_ORENI (APH domain-containing protein n=12 Tax=Pseudocrenilabrinae TaxID=318546 RepID=I3K3N3_ORENI) HSP 1 Score: 56.2 bits (134), Expect = 3.360e-7 Identity = 30/75 (40.00%), Postives = 45/75 (60.00%), Query Frame = 1 Query: 13 KPSVAMDQASTIAALLFGLTSASVESLPSYDDNNFKITASSGDIYTLKVQNGVESEDLSLLEAQSALAMRLNANG 237 KP+++ Q S I L+ LT++ ++SLPSYDD NF + S G Y LK+ N +S++ L+E Q+ L NG Sbjct: 6 KPNLSHSQVSEIVKRLYRLTASVIQSLPSYDDQNFYVAPSEGGEYILKIMNSEDSKNTLLIEVQTYAMSVLQQNG 80
BLAST of mRNA_P-wetherbeei_contig11732.1.1 vs. uniprot
Match: UPI00192F84F4 (hydroxylysine kinase n=1 Tax=Crotalus tigris TaxID=88082 RepID=UPI00192F84F4) HSP 1 Score: 51.6 bits (122), Expect = 1.440e-5 Identity = 31/86 (36.05%), Postives = 52/86 (60.47%), Query Frame = 1 Query: 1 RKRLKPSVAMDQASTIAALLFGLTSASVESLPSYDDNNFKITASS----GDI---YTLKVQNGVESEDLSLLEAQSALAMRLNANG 237 R +KP+ QA+ + +FGL + ++SLPSYDD NF ++A+S G+ + LK+ N +S++ L+E Q+ + M LN+ G Sbjct: 10 RPLIKPTFTEKQAAELVRRIFGLEVSQLKSLPSYDDQNFHLSAASFPEKGESTRDFVLKIINAEDSKNTDLIEVQTQIMMFLNSEG 95
BLAST of mRNA_P-wetherbeei_contig11732.1.1 vs. uniprot
Match: UPI00062AB9B2 (hydroxylysine kinase isoform X1 n=2 Tax=Dasypus novemcinctus TaxID=9361 RepID=UPI00062AB9B2) HSP 1 Score: 49.3 bits (116), Expect = 4.810e-5 Identity = 32/82 (39.02%), Postives = 47/82 (57.32%), Query Frame = 1 Query: 13 KPSVAMDQASTIAALLFGLTSASVESLPSYDDNNFKITAS-----SGDI--YTLKVQNGVESEDLSLLEAQSALAMRLNANG 237 KP+ + QAST+ +FGL + ++SLPSYDD NF + S +G + Y LK+ N S+ L+E Q+ + M L A G Sbjct: 19 KPTFSEVQASTLVESVFGLKVSKIQSLPSYDDQNFHVYISRTKDSTGGLTEYVLKISNTETSKTPDLIEVQTHIIMFLRATG 100
BLAST of mRNA_P-wetherbeei_contig11732.1.1 vs. uniprot
Match: UPI0018D028C4 (hydroxylysine kinase isoform X1 n=2 Tax=Plutella xylostella TaxID=51655 RepID=UPI0018D028C4) HSP 1 Score: 50.1 bits (118), Expect = 5.050e-5 Identity = 28/91 (30.77%), Postives = 49/91 (53.85%), Query Frame = 1 Query: 10 LKPSVAMDQASTIAALLFGLTSASVESLPSYDDNNFKI-----------TASSGDIYTLKVQNGVESEDLSLLEAQSALAMRLNANGCTCP 249 +KP + ++ + L+G++ +E L YDD N+KI T S + Y LK+ N ++S++LS++EAQ+ + + A TCP Sbjct: 17 IKPIITHEEVKLLVERLYGISVLELEELNGYDDKNYKIIEDPNVKNPLITNHSTEGYVLKIMNSMDSQNLSVVEAQNEIMNFITARSITCP 107 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig11732.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 11
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig11732.1.1 >prot_P-wetherbeei_contig11732.1.1 ID=prot_P-wetherbeei_contig11732.1.1|Name=mRNA_P-wetherbeei_contig11732.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=82bp MDQASTIAALLFGLTSASVESLPSYDDNNFKITASSGDIYTLKVQNGVESback to top mRNA from alignment at P-wetherbeei_contig11732:1206..1753+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig11732.1.1 ID=mRNA_P-wetherbeei_contig11732.1.1|Name=mRNA_P-wetherbeei_contig11732.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=548bp|location=Sequence derived from alignment at P-wetherbeei_contig11732:1206..1753+ (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig11732:1206..1753+ >mRNA_P-wetherbeei_contig11732.1.1 ID=mRNA_P-wetherbeei_contig11732.1.1|Name=mRNA_P-wetherbeei_contig11732.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=246bp|location=Sequence derived from alignment at P-wetherbeei_contig11732:1206..1753+ (Phaeothamnion wetherbeei SAG_119_79)back to top |