mRNA_P-wetherbeei_contig10949.1.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig10949.1.1 vs. uniprot
Match: UPI0016645BEC (SDR family oxidoreductase n=1 Tax=Hymenobacter cavernae TaxID=2044852 RepID=UPI0016645BEC) HSP 1 Score: 58.2 bits (139), Expect = 1.040e-8 Identity = 33/49 (67.35%), Postives = 37/49 (75.51%), Query Frame = 1 Query: 4 PYALVTGATSGIGRAVAAELAARGYNLVLVGRSEDSLAAAAVELRAAGR 150 PYALVTGA+ GIGRA+A +LA RGYNL+LV RS D LA A EL A R Sbjct: 2 PYALVTGASRGIGRAIATDLARRGYNLLLVARSADVLAQLATELGQAHR 50
BLAST of mRNA_P-wetherbeei_contig10949.1.1 vs. uniprot
Match: A0A7C9TQU5_9MICO (SDR family oxidoreductase n=1 Tax=Galbitalea soli TaxID=1268042 RepID=A0A7C9TQU5_9MICO) HSP 1 Score: 57.8 bits (138), Expect = 1.420e-8 Identity = 34/47 (72.34%), Postives = 37/47 (78.72%), Query Frame = 1 Query: 10 ALVTGATSGIGRAVAAELAARGYNLVLVGRSEDSLAAAAVELRAAGR 150 ALVTG TSGIG A A +LAARGY+LVLV RSE+ LA A ELRA GR Sbjct: 4 ALVTGGTSGIGAAFARKLAARGYDLVLVARSEERLAEMATELRALGR 50
BLAST of mRNA_P-wetherbeei_contig10949.1.1 vs. uniprot
Match: R7SK39_DICSQ (NAD(P)-binding protein n=6 Tax=Dichomitus squalens TaxID=114155 RepID=R7SK39_DICSQ) HSP 1 Score: 57.4 bits (137), Expect = 2.500e-8 Identity = 31/50 (62.00%), Postives = 38/50 (76.00%), Query Frame = 1 Query: 1 APYALVTGATSGIGRAVAAELAARGYNLVLVGRSEDSLAAAAVELRAAGR 150 APYA+VTGAT GIG+A AAEL ARG+N+VL GR+E + ELRA G+ Sbjct: 50 APYAIVTGATDGIGKATAAELLARGFNVVLHGRNEAKMQQVVRELRAQGK 99
BLAST of mRNA_P-wetherbeei_contig10949.1.1 vs. uniprot
Match: A0A835ZD17_9STRA (Uncharacterized protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835ZD17_9STRA) HSP 1 Score: 57.4 bits (137), Expect = 2.590e-8 Identity = 33/54 (61.11%), Postives = 43/54 (79.63%), Query Frame = 1 Query: 1 APYALVTGATSGIGRAVAAELAARGYNLVLVGRSEDSLA----AAAVELRAAGR 150 APYA+VTGA+SGIGRA+AA+LA +G+N+VL+GR+ D+L A E RAAGR Sbjct: 92 APYAVVTGASSGIGRAIAADLARQGWNVVLIGRNRDALREHARALKREARAAGR 145
BLAST of mRNA_P-wetherbeei_contig10949.1.1 vs. uniprot
Match: A0A165R6Q2_9APHY (NAD(P)-binding protein n=1 Tax=Daedalea quercina L-15889 TaxID=1314783 RepID=A0A165R6Q2_9APHY) HSP 1 Score: 56.6 bits (135), Expect = 4.680e-8 Identity = 30/50 (60.00%), Postives = 38/50 (76.00%), Query Frame = 1 Query: 1 APYALVTGATSGIGRAVAAELAARGYNLVLVGRSEDSLAAAAVELRAAGR 150 APYALVTGAT GIG+AVA EL A+G+NL++ GR+E + EL+A GR Sbjct: 56 APYALVTGATDGIGKAVAQELFAKGFNLIIHGRNEAKIQKVVEELKAQGR 105
BLAST of mRNA_P-wetherbeei_contig10949.1.1 vs. uniprot
Match: S8DLA8_FOMPI (NAD-binding protein n=1 Tax=Fomitopsis pinicola (strain FP-58527) TaxID=743788 RepID=S8DLA8_FOMPI) HSP 1 Score: 55.8 bits (133), Expect = 8.900e-8 Identity = 27/49 (55.10%), Postives = 38/49 (77.55%), Query Frame = 1 Query: 1 APYALVTGATSGIGRAVAAELAARGYNLVLVGRSEDSLAAAAVELRAAG 147 APYA+VTGAT GIG+AVA EL RG+NL++ GR+E+ + E++A+G Sbjct: 65 APYAIVTGATDGIGKAVARELFGRGFNLIIHGRNEEKIRTVIAEIKASG 113
BLAST of mRNA_P-wetherbeei_contig10949.1.1 vs. uniprot
Match: A0A2M9B568_9BACT (Uncharacterized protein n=2 Tax=Hymenobacter TaxID=89966 RepID=A0A2M9B568_9BACT) HSP 1 Score: 55.5 bits (132), Expect = 1.000e-7 Identity = 29/44 (65.91%), Postives = 35/44 (79.55%), Query Frame = 1 Query: 4 PYALVTGATSGIGRAVAAELAARGYNLVLVGRSEDSLAAAAVEL 135 PYAL+TGA+ GIGRA+A ELA RGY+L+L RS+D LA A EL Sbjct: 2 PYALITGASRGIGRALAHELAQRGYSLLLTARSQDQLAQVATEL 45
BLAST of mRNA_P-wetherbeei_contig10949.1.1 vs. uniprot
Match: A0A5B8A0Z0_9BACT (SDR family oxidoreductase n=2 Tax=Hymenobacter TaxID=89966 RepID=A0A5B8A0Z0_9BACT) HSP 1 Score: 55.5 bits (132), Expect = 1.000e-7 Identity = 29/44 (65.91%), Postives = 35/44 (79.55%), Query Frame = 1 Query: 7 YALVTGATSGIGRAVAAELAARGYNLVLVGRSEDSLAAAAVELR 138 YALVTGA+ GIG+A+A ELA RGYNL+L RSED+L A +LR Sbjct: 3 YALVTGASRGIGQAIATELARRGYNLLLTARSEDALEKVAAQLR 46
BLAST of mRNA_P-wetherbeei_contig10949.1.1 vs. uniprot
Match: UPI001FF2D13F (SDR family NAD(P)-dependent oxidoreductase n=1 Tax=Blastococcus sp. PRF04-17 TaxID=2933797 RepID=UPI001FF2D13F) HSP 1 Score: 55.5 bits (132), Expect = 1.150e-7 Identity = 32/48 (66.67%), Postives = 35/48 (72.92%), Query Frame = 1 Query: 4 PYALVTGATSGIGRAVAAELAARGYNLVLVGRSEDSLAAAAVELRAAG 147 P L+TGA+SGIGRA A ELA RG LVLV R E+SL AA E RAAG Sbjct: 8 PTVLITGASSGIGRATAKELAGRGATLVLVSRGEESLEEAAAEARAAG 55
BLAST of mRNA_P-wetherbeei_contig10949.1.1 vs. uniprot
Match: A0A2K2D3W1_BRADI (Uncharacterized protein n=1 Tax=Brachypodium distachyon TaxID=15368 RepID=A0A2K2D3W1_BRADI) HSP 1 Score: 55.1 bits (131), Expect = 1.520e-7 Identity = 30/46 (65.22%), Postives = 37/46 (80.43%), Query Frame = 1 Query: 4 PYALVTGATSGIGRAVAAELAARGYNLVLVGRSEDSLAAAAVELRA 141 P+A+VTGAT GIGRA+A LAA G +LVLVGR+ D LAA + E+RA Sbjct: 123 PWAVVTGATDGIGRAIAFRLAASGLSLVLVGRNPDKLAAVSEEIRA 168 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig10949.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig10949.1.1 >prot_P-wetherbeei_contig10949.1.1 ID=prot_P-wetherbeei_contig10949.1.1|Name=mRNA_P-wetherbeei_contig10949.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=50bp APYALVTGATSGIGRAVAAELAARGYNLVLVGRSEDSLAAAAVELRAAGRback to top mRNA from alignment at P-wetherbeei_contig10949:17..166- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig10949.1.1 ID=mRNA_P-wetherbeei_contig10949.1.1|Name=mRNA_P-wetherbeei_contig10949.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=150bp|location=Sequence derived from alignment at P-wetherbeei_contig10949:17..166- (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig10949:17..166- >mRNA_P-wetherbeei_contig10949.1.1 ID=mRNA_P-wetherbeei_contig10949.1.1|Name=mRNA_P-wetherbeei_contig10949.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=150bp|location=Sequence derived from alignment at P-wetherbeei_contig10949:17..166- (Phaeothamnion wetherbeei SAG_119_79)back to top |