mRNA_P-wetherbeei_contig10328.1.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig10328.1.1 vs. uniprot
Match: D8LJX1_ECTSI (RING-type E3 ubiquitin transferase n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LJX1_ECTSI) HSP 1 Score: 93.2 bits (230), Expect = 1.320e-20 Identity = 40/81 (49.38%), Postives = 58/81 (71.60%), Query Frame = 1 Query: 1 CIKSWRQSTTVEKGVSRSCPSCRRLSHFVVPSKVHCEGEAKARVIENYKKTLAVLPCRYFKPPAEGRPGTS--CPFGASCF 237 C+++WR+S +K +SR+CP CR++S F+VPSK H +G+AK + I+ YKK L+ LPC+Y KP GT+ CPFG+ CF Sbjct: 196 CLRTWRKSKGPQKDISRTCPECRKVSFFLVPSKEHLKGKAKLKAIQAYKKGLSKLPCKYHKPGKASGGGTTTVCPFGSRCF 276
BLAST of mRNA_P-wetherbeei_contig10328.1.1 vs. uniprot
Match: A0A6H5JI27_9PHAE (RING-type E3 ubiquitin transferase n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JI27_9PHAE) HSP 1 Score: 91.3 bits (225), Expect = 6.520e-20 Identity = 39/81 (48.15%), Postives = 58/81 (71.60%), Query Frame = 1 Query: 1 CIKSWRQSTTVEKGVSRSCPSCRRLSHFVVPSKVHCEGEAKARVIENYKKTLAVLPCRYFKPPAEGRPGTS--CPFGASCF 237 C+++WR+S +K +SR+CP CR++S F+VPSK H +G+AK + I+ YK+ L+ LPC+Y KP GT+ CPFG+ CF Sbjct: 198 CLRTWRKSKGPQKDISRTCPECRKVSFFLVPSKEHLKGKAKLKAIQAYKQGLSKLPCKYHKPGNASGGGTTTVCPFGSRCF 278
BLAST of mRNA_P-wetherbeei_contig10328.1.1 vs. uniprot
Match: A0A7R9YAR0_9STRA (RING-type E3 ubiquitin transferase n=1 Tax=Pinguiococcus pyrenoidosus TaxID=172671 RepID=A0A7R9YAR0_9STRA) HSP 1 Score: 72.4 bits (176), Expect = 1.960e-13 Identity = 33/79 (41.77%), Postives = 47/79 (59.49%), Query Frame = 1 Query: 1 CIKSWRQSTTVEKGVSRSCPSCRRLSHFVVPSKVHCEGEAKARVIENYKKTLAVLPCRYFKPPAEGRPGTSCPFGASCF 237 CI++WR+ R+CP+CR S+F +P + GE K +VIE+YKK L+ +PCRYF G +CPF + CF Sbjct: 114 CIRTWRKEGCGSATHKRTCPTCRTTSNFFMPHFEYVRGEKKHQVIEDYKKRLSEIPCRYFSR------GETCPFRSECF 186
BLAST of mRNA_P-wetherbeei_contig10328.1.1 vs. uniprot
Match: A0A1R2CD08_9CILI (RING-type E3 ubiquitin transferase n=1 Tax=Stentor coeruleus TaxID=5963 RepID=A0A1R2CD08_9CILI) HSP 1 Score: 71.6 bits (174), Expect = 2.740e-13 Identity = 34/80 (42.50%), Postives = 48/80 (60.00%), Query Frame = 1 Query: 1 CIKSWRQSTTVEKGVSRSCPSCRRLSHFVVPSKVHCEG-EAKARVIENYKKTLAVLPCRYFKPPAEGRPGTSCPFGASCF 237 CI+ WR K V RSCP CR LSH+++PS + E + K ++ + YK L +PC++F EG +CPFG+SCF Sbjct: 92 CIRKWRGQLNAPKEVVRSCPLCRTLSHYIIPSPEYIESYQEKMKLADQYKVKLGNIPCKFFNY-GEG----TCPFGSSCF 166
BLAST of mRNA_P-wetherbeei_contig10328.1.1 vs. uniprot
Match: A0A5A7PYE0_STRAF (RING-type E3 ubiquitin transferase n=1 Tax=Striga asiatica TaxID=4170 RepID=A0A5A7PYE0_STRAF) HSP 1 Score: 72.0 bits (175), Expect = 3.160e-13 Identity = 40/84 (47.62%), Postives = 51/84 (60.71%), Query Frame = 1 Query: 1 CIKSWRQSTTVE----KGVSRSCPSCRRLSHFVVPSKV-HCEGEAKARVIENYKKTLAVLPCRYFKPPAEGRPGTSCPFGASCF 237 CI+SWR ST V SRSCP CRRLS+FVVPS V + E K ++++YK L + C++F +G CPFGASCF Sbjct: 168 CIRSWRSSTPVPGIDASSASRSCPVCRRLSYFVVPSFVWYSSMEEKKEIVDSYKARLRCIDCKHFDF-GDG----CCPFGASCF 246
BLAST of mRNA_P-wetherbeei_contig10328.1.1 vs. uniprot
Match: A0A2I0ITS2_PUNGR (RING-type E3 ubiquitin transferase n=3 Tax=Punica granatum TaxID=22663 RepID=A0A2I0ITS2_PUNGR) HSP 1 Score: 72.0 bits (175), Expect = 6.070e-13 Identity = 36/84 (42.86%), Postives = 51/84 (60.71%), Query Frame = 1 Query: 1 CIKSWRQSTTVE----KGVSRSCPSCRRLSHFVVPSKV-HCEGEAKARVIENYKKTLAVLPCRYFKPPAEGRPGTSCPFGASCF 237 CI++WR+S+ SRSCP CR+LS+FVVPS + + E K R+I NYK L ++ C++F +CPFG+SCF Sbjct: 282 CIRNWRRSSPASGMDVNSASRSCPICRKLSYFVVPSDIWYTTKEEKERIISNYKARLKLIDCKHFN-----FGNGNCPFGSSCF 360
BLAST of mRNA_P-wetherbeei_contig10328.1.1 vs. uniprot
Match: A0A7S0NYN6_9EUKA (RING-type E3 ubiquitin transferase n=1 Tax=Calcidiscus leptoporus TaxID=127549 RepID=A0A7S0NYN6_9EUKA) HSP 1 Score: 68.9 bits (167), Expect = 1.550e-12 Identity = 39/80 (48.75%), Postives = 49/80 (61.25%), Query Frame = 1 Query: 1 CIKSWRQSTTVEKGVSRSCPSCRRLSHFVVPSKVH-CEGEAKARVIENYKKTLAVLPCRYFKPPAEGRPGTSCPFGASCF 237 CI+ WR + V V+RSCP CR LS+FVVPS V C K ++I+ Y L+ LPC++F A G GT C FG SCF Sbjct: 63 CIRRWRATHAVRPQVARSCPECRVLSNFVVPSPVFLCHPLRKEQLIQGYLNRLSSLPCKHF---AFGE-GT-CAFGTSCF 137
BLAST of mRNA_P-wetherbeei_contig10328.1.1 vs. uniprot
Match: UPI000711FB5B (zinc finger family protein n=1 Tax=Blastocystis sp. subtype 4 TaxID=944170 RepID=UPI000711FB5B) HSP 1 Score: 69.7 bits (169), Expect = 1.580e-12 Identity = 36/80 (45.00%), Postives = 47/80 (58.75%), Query Frame = 1 Query: 1 CIKSWRQSTTVEKGVSRSCPSCRRLSHFVVPSKVHC-EGEAKARVIENYKKTLAVLPCRYFKPPAEGRPGTSCPFGASCF 237 CI++WR S + V R CP CR S +V+PS + E K R++E YKK +A +PC+YF G G CPFG SCF Sbjct: 121 CIRNWRYSNLGDPNVRR-CPLCRATSFYVIPSNEPIFDPEVKQRIVEEYKKNMAKIPCKYFN----GGKGV-CPFGESCF 194
BLAST of mRNA_P-wetherbeei_contig10328.1.1 vs. uniprot
Match: A0A8C4A998_9TELE (E3 ubiquitin-protein ligase makorin-2 n=3 Tax=Denticeps clupeoides TaxID=299321 RepID=A0A8C4A998_9TELE) HSP 1 Score: 70.1 bits (170), Expect = 2.810e-12 Identity = 37/80 (46.25%), Postives = 49/80 (61.25%), Query Frame = 1 Query: 1 CIKSWRQSTTVEKGVSRSCPSCRRLSHFVVPSKVHCEG-EAKARVIENYKKTLAVLPCRYFKPPAEGRPGTSCPFGASCF 237 CI+ WR + E + +SCP CR +S FV+PS E E K R+IE +K ++ PC+YF +GR GT CPFGA CF Sbjct: 272 CIRQWRCAKQFENKIIKSCPECRVVSEFVIPSMYWVEDQEEKNRLIEEFKSGVSKKPCKYFD---QGR-GT-CPFGAKCF 346
BLAST of mRNA_P-wetherbeei_contig10328.1.1 vs. uniprot
Match: A0A2H9TJR6_9FUNG (RING-type E3 ubiquitin transferase n=1 Tax=Paramicrosporidium saccamoebae TaxID=1246581 RepID=A0A2H9TJR6_9FUNG) HSP 1 Score: 69.7 bits (169), Expect = 4.140e-12 Identity = 34/80 (42.50%), Postives = 47/80 (58.75%), Query Frame = 1 Query: 1 CIKSWRQSTTVEKGVSRSCPSCRRLSHFVVPSKVHCEG-EAKARVIENYKKTLAVLPCRYFKPPAEGRPGTSCPFGASCF 237 CI++WR T+ ++SCP CR +++F++PS G E K R+IE YKK L + C+YF E CPFG SCF Sbjct: 413 CIRTWRGKHTMHDLATKSCPLCRVVTYFIIPSSTWTTGIEEKQRIIEAYKKKLGEIDCKYFYYGDE-----VCPFGGSCF 487 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig10328.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig10328.1.1 >prot_P-wetherbeei_contig10328.1.1 ID=prot_P-wetherbeei_contig10328.1.1|Name=mRNA_P-wetherbeei_contig10328.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=79bp CIKSWRQSTTVEKGVSRSCPSCRRLSHFVVPSKVHCEGEAKARVIENYKKback to top mRNA from alignment at P-wetherbeei_contig10328:1913..2149- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig10328.1.1 ID=mRNA_P-wetherbeei_contig10328.1.1|Name=mRNA_P-wetherbeei_contig10328.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=237bp|location=Sequence derived from alignment at P-wetherbeei_contig10328:1913..2149- (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig10328:1913..2149- >mRNA_P-wetherbeei_contig10328.1.1 ID=mRNA_P-wetherbeei_contig10328.1.1|Name=mRNA_P-wetherbeei_contig10328.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=237bp|location=Sequence derived from alignment at P-wetherbeei_contig10328:1913..2149- (Phaeothamnion wetherbeei SAG_119_79)back to top |