mRNA_P-wetherbeei_contig1032.4.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig1032.4.1 vs. uniprot
Match: A0A2R5G436_9STRA (Uncharacterized protein n=1 Tax=Hondaea fermentalgiana TaxID=2315210 RepID=A0A2R5G436_9STRA) HSP 1 Score: 54.3 bits (129), Expect = 5.700e-8 Identity = 25/34 (73.53%), Postives = 26/34 (76.47%), Query Frame = 1 Query: 7 TTAVAVGYSTGFLPLKIPLAPLLNVVFCWFPFFD 108 TT V STGFLPL IPLAPLLN+V CWFPF D Sbjct: 93 TTLKVVDGSTGFLPLTIPLAPLLNIVLCWFPFGD 126
BLAST of mRNA_P-wetherbeei_contig1032.4.1 vs. uniprot
Match: D7FLG9_ECTSI (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7FLG9_ECTSI) HSP 1 Score: 46.6 bits (109), Expect = 6.830e-5 Identity = 20/28 (71.43%), Postives = 23/28 (82.14%), Query Frame = 1 Query: 25 GYSTGFLPLKIPLAPLLNVVFCWFPFFD 108 GYSTGFLPLKIPLA L+N+ C+ PF D Sbjct: 142 GYSTGFLPLKIPLACLINIPLCFIPFSD 169 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig1032.4.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig1032.4.1 >prot_P-wetherbeei_contig1032.4.1 ID=prot_P-wetherbeei_contig1032.4.1|Name=mRNA_P-wetherbeei_contig1032.4.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=36bp GATTAVAVGYSTGFLPLKIPLAPLLNVVFCWFPFFDback to top mRNA from alignment at P-wetherbeei_contig1032:7705..7812- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig1032.4.1 ID=mRNA_P-wetherbeei_contig1032.4.1|Name=mRNA_P-wetherbeei_contig1032.4.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=108bp|location=Sequence derived from alignment at P-wetherbeei_contig1032:7705..7812- (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig1032:7705..7812- >mRNA_P-wetherbeei_contig1032.4.1 ID=mRNA_P-wetherbeei_contig1032.4.1|Name=mRNA_P-wetherbeei_contig1032.4.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=108bp|location=Sequence derived from alignment at P-wetherbeei_contig1032:7705..7812- (Phaeothamnion wetherbeei SAG_119_79)back to top |