mRNA_P-wetherbeei_contig10170.2.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig10170.2.1 vs. uniprot
Match: A0A1V4I876_9CLOT (Glucan endo-1,3-beta-glucosidase A1 n=1 Tax=Clostridium oryzae TaxID=1450648 RepID=A0A1V4I876_9CLOT) HSP 1 Score: 90.9 bits (224), Expect = 1.230e-19 Identity = 39/85 (45.88%), Postives = 57/85 (67.06%), Query Frame = 1 Query: 1 FHVYAIEWSPDSMTWFIDGKETCKKTTWYS-----ALSKRKTAPFDVPFYMLLNLAIGGMYTEGAIVDDSKFPLTMQVDYVRVYQ 240 +H Y+IEW+ + + W++DG++ + WY+ A+ APF+ PFY+LLNLA+GG + GA D++K P MQVDYVRVYQ Sbjct: 211 YHTYSIEWNSNRIDWYVDGRKYYSENKWYTKSEDKAIDSSYPAPFNRPFYLLLNLAVGGNFDNGAAPDNAKLPAKMQVDYVRVYQ 295
BLAST of mRNA_P-wetherbeei_contig10170.2.1 vs. uniprot
Match: A0A1G5CWB8_9BACL (Glycosyl hydrolases family 16 n=12 Tax=Paenibacillus TaxID=44249 RepID=A0A1G5CWB8_9BACL) HSP 1 Score: 90.9 bits (224), Expect = 1.530e-19 Identity = 43/83 (51.81%), Postives = 56/83 (67.47%), Query Frame = 1 Query: 1 FHVYAIEWSPDSMTWFIDGKETCKKTT--WYSALSKRK-TAPFDVPFYMLLNLAIGGMYTEGAIVDDSKFPLTMQVDYVRVYQ 240 +HVY++ W PD++ W++DGK K T W SA + APFD PFY+++NLAIGG + G I D S P TMQVDYVRVY+ Sbjct: 598 YHVYSVVWEPDNIKWYVDGKFFYKVTNQQWSSAAAPNNPNAPFDEPFYLIMNLAIGGNFDGGRIPDASDIPATMQVDYVRVYK 680
BLAST of mRNA_P-wetherbeei_contig10170.2.1 vs. uniprot
Match: A0A2M9ML35_9BACL (Glucan endo-1,3-beta-glucosidase A1 n=20 Tax=Bacillales TaxID=1385 RepID=A0A2M9ML35_9BACL) HSP 1 Score: 90.9 bits (224), Expect = 1.540e-19 Identity = 43/83 (51.81%), Postives = 55/83 (66.27%), Query Frame = 1 Query: 1 FHVYAIEWSPDSMTWFIDGKETCKKTT--WYSALSKRK-TAPFDVPFYMLLNLAIGGMYTEGAIVDDSKFPLTMQVDYVRVYQ 240 +HVY++ W DS+ W++DGK K T WYSA + APFD PFY+++NLAIGG + G D S P TMQVDYVRVY+ Sbjct: 601 YHVYSVVWEEDSIKWYVDGKFFFKVTRDQWYSAAAPNNPNAPFDQPFYLIMNLAIGGTFDGGRTPDPSDIPATMQVDYVRVYK 683
BLAST of mRNA_P-wetherbeei_contig10170.2.1 vs. uniprot
Match: A0A2V2YUT2_9BACL (Beta-glucanase (GH16 family) n=1 Tax=Paenibacillus cellulosilyticus TaxID=375489 RepID=A0A2V2YUT2_9BACL) HSP 1 Score: 90.1 bits (222), Expect = 2.870e-19 Identity = 42/83 (50.60%), Postives = 54/83 (65.06%), Query Frame = 1 Query: 1 FHVYAIEWSPDSMTWFIDGKETCK--KTTWYS-ALSKRKTAPFDVPFYMLLNLAIGGMYTEGAIVDDSKFPLTMQVDYVRVYQ 240 FHVY++ W D++ W++DGK K + WYS A APFD PFY+++NLA+GG + G D S P TMQVDYVRVYQ Sbjct: 591 FHVYSVVWEEDNVKWYVDGKFFLKVSREQWYSVAAPNNPNAPFDQPFYLIMNLAVGGHFDGGLSPDPSDIPATMQVDYVRVYQ 673
BLAST of mRNA_P-wetherbeei_contig10170.2.1 vs. uniprot
Match: UPI000AF23BEC (family 16 glycosylhydrolase n=1 Tax=Paenibacillus sp. DMB20 TaxID=1642570 RepID=UPI000AF23BEC) HSP 1 Score: 89.4 bits (220), Expect = 3.060e-19 Identity = 42/83 (50.60%), Postives = 55/83 (66.27%), Query Frame = 1 Query: 1 FHVYAIEWSPDSMTWFIDGKETCKKTT--WYSALSKRK-TAPFDVPFYMLLNLAIGGMYTEGAIVDDSKFPLTMQVDYVRVYQ 240 +HVY++ W D++ W++DGK K T WYSA + APFD PFY+++NLAIGG + G D S P TMQVDYVRVY+ Sbjct: 114 YHVYSVVWEGDNIKWYVDGKFFFKATRDQWYSAAAPNNPNAPFDQPFYLIMNLAIGGNFDGGRTPDPSDIPATMQVDYVRVYK 196
BLAST of mRNA_P-wetherbeei_contig10170.2.1 vs. uniprot
Match: UPI00135A6793 (family 16 glycosylhydrolase n=1 Tax=Paenibacillus TaxID=44249 RepID=UPI00135A6793) HSP 1 Score: 89.7 bits (221), Expect = 3.920e-19 Identity = 42/83 (50.60%), Postives = 55/83 (66.27%), Query Frame = 1 Query: 1 FHVYAIEWSPDSMTWFIDGKETCKKTT--WYSALSKRK-TAPFDVPFYMLLNLAIGGMYTEGAIVDDSKFPLTMQVDYVRVYQ 240 +HVY++ W D++ W++DGK K T WYSA + APFD PFY+++NLAIGG + G D S P TMQVDYVRVY+ Sbjct: 601 YHVYSVVWEEDNIKWYVDGKFFFKTTRDQWYSAAAPNNPNAPFDQPFYLIMNLAIGGAFDGGHTPDPSDIPATMQVDYVRVYK 683
BLAST of mRNA_P-wetherbeei_contig10170.2.1 vs. uniprot
Match: A0A3D4D0Q9_9BACT (GH16 domain-containing protein n=1 Tax=Verrucomicrobiales bacterium TaxID=2026801 RepID=A0A3D4D0Q9_9BACT) HSP 1 Score: 84.3 bits (207), Expect = 6.230e-19 Identity = 41/88 (46.59%), Postives = 61/88 (69.32%), Query Frame = 1 Query: 1 FHVYAIEWSPDSMTWFIDGK--ETCKKTTWYSALSKRK-TAPFDVPFYMLLNLAIGGMYTE-----GAIVDDSKFPLTMQVDYVRVYQ 240 FHVYA+EWS D ++WF+DG +T K + W+SA +++ +AP+D PF+++LN+A+ G + E + S+FP MQVDYVRVYQ Sbjct: 63 FHVYALEWSADEISWFVDGVRWKTRKASEWWSASARQNPSAPYDQPFHLILNVAVDGRFFEKEDQRADRIPASQFPQVMQVDYVRVYQ 150
BLAST of mRNA_P-wetherbeei_contig10170.2.1 vs. uniprot
Match: A0A2E3H7Q5_9BACT (GH16 domain-containing protein n=1 Tax=Roseibacillus sp. TaxID=2024856 RepID=A0A2E3H7Q5_9BACT) HSP 1 Score: 87.8 bits (216), Expect = 7.030e-19 Identity = 41/88 (46.59%), Postives = 63/88 (71.59%), Query Frame = 1 Query: 1 FHVYAIEWSPDSMTWFIDGKE--TCKKTTWYSALSKRK-TAPFDVPFYMLLNLAIGGMYTE-----GAIVDDSKFPLTMQVDYVRVYQ 240 FHVYA+EWS D ++WF+DG++ T +K+ W+SA +++ +AP+D PF+++LN+A+ G + E + S+FP MQVDYVRVYQ Sbjct: 245 FHVYAVEWSADEISWFVDGRKWKTRRKSEWWSASARKNPSAPYDQPFHLILNVAVDGRFFEKEDQKADRIPASQFPQVMQVDYVRVYQ 332
BLAST of mRNA_P-wetherbeei_contig10170.2.1 vs. uniprot
Match: A0A1R0Y003_9BACL (Glucan endo-1,3-beta-D-glucosidase n=26 Tax=Paenibacillus TaxID=44249 RepID=A0A1R0Y003_9BACL) HSP 1 Score: 89.0 bits (219), Expect = 7.310e-19 Identity = 42/83 (50.60%), Postives = 54/83 (65.06%), Query Frame = 1 Query: 1 FHVYAIEWSPDSMTWFIDGKETCK--KTTWYS-ALSKRKTAPFDVPFYMLLNLAIGGMYTEGAIVDDSKFPLTMQVDYVRVYQ 240 +HVY++ W D+M W++DGK K + WYS A APFD PFY+++NLAIGG + G D S P TMQVDYVRVY+ Sbjct: 598 YHVYSMVWEEDNMKWYVDGKFFFKVSRDQWYSVAAPNNPNAPFDQPFYIIMNLAIGGYFDNGHTPDPSDIPATMQVDYVRVYK 680
BLAST of mRNA_P-wetherbeei_contig10170.2.1 vs. uniprot
Match: A0A0M1N1S0_9BACL (Glucan endo-1,3-beta-D-glucosidase n=1 Tax=Paenibacillus solani TaxID=1705565 RepID=A0A0M1N1S0_9BACL) HSP 1 Score: 89.0 bits (219), Expect = 7.310e-19 Identity = 41/83 (49.40%), Postives = 55/83 (66.27%), Query Frame = 1 Query: 1 FHVYAIEWSPDSMTWFIDGKETCKKTT--WYSALSKRK-TAPFDVPFYMLLNLAIGGMYTEGAIVDDSKFPLTMQVDYVRVYQ 240 +HVY++ W D++ W++DGK K T WYSA + APFD PFY+++NLA+GG + G D S P TMQVDYVRVY+ Sbjct: 600 YHVYSVVWEEDNIKWYVDGKFFFKVTRDQWYSAAAPNNPNAPFDQPFYLIMNLALGGTFDGGRTPDPSDIPATMQVDYVRVYK 682 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig10170.2.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig10170.2.1 >prot_P-wetherbeei_contig10170.2.1 ID=prot_P-wetherbeei_contig10170.2.1|Name=mRNA_P-wetherbeei_contig10170.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=80bp FHVYAIEWSPDSMTWFIDGKETCKKTTWYSALSKRKTAPFDVPFYMLLNLback to top mRNA from alignment at P-wetherbeei_contig10170:1120..1359- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig10170.2.1 ID=mRNA_P-wetherbeei_contig10170.2.1|Name=mRNA_P-wetherbeei_contig10170.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=240bp|location=Sequence derived from alignment at P-wetherbeei_contig10170:1120..1359- (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig10170:1120..1359- >mRNA_P-wetherbeei_contig10170.2.1 ID=mRNA_P-wetherbeei_contig10170.2.1|Name=mRNA_P-wetherbeei_contig10170.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=240bp|location=Sequence derived from alignment at P-wetherbeei_contig10170:1120..1359- (Phaeothamnion wetherbeei SAG_119_79)back to top |