prot_P-canaliculata_contig99818.24099.1 (polypeptide) Pelvetia canaliculata dioecious

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_P-canaliculata_contig99818.24099.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 15
ZOOM
x 1
POSITION
0
VPTEVDSSPAQGNGGGGQTIYHRWESCFHPTGMKFTGSSNPSNAVLADAGSWDRVFSERKAIKMVKLVHRES*10203040506070Expect = 2.64e-15 / Id = 46.67Expect = 3.24e-15 / Id = 50.00Expect = 4.43e-15 / Id = 48.72Expect = 1.40e-13 / Id = 50.00Expect = 3.84e-13 / Id = 49.37Expect = 7.02e-13 / Id = 50.00Expect = 1.31e-12 / Id = 44.30Expect = 1.78e-12 / Id = 46.67Expect = 6.46e-12 / Id = 45.95Expect = 6.26e-11 / Id = 44.30SequenceA0A6P0ZIN1_9CYANA0A516LEJ2_9VIRUA0A7G5B066_9CAUDA0A2H4GY17_9CAUDA0A7G3PH87_9CAUDA0A2E0NP38_9GAMMA0A1H2ENG7_9PROTA0A7D2LI04_9CAUDA0A6J5PIK2_9CAUDA0A516LHR7_9VIRU
Match NameE-valueIdentityDescription
A0A6P0ZIN1_9CYAN2.640e-1546.67Uncharacterized protein n=1 Tax=Sphaerospermopsis ... [more]
A0A516LEJ2_9VIRU3.240e-1550.00Putative major capsid protein n=1 Tax=Prokaryotic ... [more]
A0A7G5B066_9CAUD4.430e-1548.72Major capsid protein n=3 Tax=unclassified Queuovir... [more]
A0A2H4GY17_9CAUD1.400e-1350.00Major head protein n=6 Tax=Nipunavirus TaxID=19822... [more]
A0A7G3PH87_9CAUD3.840e-1349.37Putative major capsid protein n=1 Tax=Sphingomonas... [more]
A0A2E0NP38_9GAMM7.020e-1350.00Uncharacterized protein n=2 Tax=Proteobacteria Tax... [more]
A0A1H2ENG7_9PROT1.310e-1244.30Uncharacterized protein n=2 Tax=Nitrosomonas ureae... [more]
A0A7D2LI04_9CAUD1.780e-1246.67Major head protein n=1 Tax=Stenotrophomonas phage ... [more]
A0A6J5PIK2_9CAUD6.460e-1245.95Uncharacterized protein n=1 Tax=uncultured Caudovi... [more]
A0A516LHR7_9VIRU6.260e-1144.30Putative major capsid protein n=1 Tax=Prokaryotic ... [more]

Pages

back to top