prot_P-canaliculata_contig9981.24097.1 (polypeptide) Pelvetia canaliculata dioecious

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_P-canaliculata_contig9981.24097.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 25
ZOOM
x 1
POSITION
0
MTLVVQDGRTTFILFFWTPRSLHFNLAWFWYHKSHFRYFFRKAYFWLFGMLNAIIFIGVLGSIVWAHHMFTVGMDIFTRAYLAAAAMIIAVPTGIKIFSWTATMWGGSIRLKTPVICNRFFIYHWRFNRCGISKFWC*20406080100120Expect = 7.82e-31 / Id = 55.45Expect = 1.30e-30 / Id = 68.67Expect = 2.84e-29 / Id = 67.47Expect = 3.21e-29 / Id = 68.67Expect = 4.58e-29 / Id = 68.67Expect = 5.09e-29 / Id = 68.67Expect = 7.26e-29 / Id = 67.47Expect = 9.31e-29 / Id = 66.27Expect = 1.02e-28 / Id = 68.67Expect = 1.03e-28 / Id = 62.65SequenceA0A3P3YW96_PLABSD6MQM8_9PHAEB4XPK9_9LILIM1EYI5_9PHAEM1F017_SARFSQ33518_9BRYOA0A8J5WG91_ZIZPAA0A6M3TIB1_9FLORD4HL93_9PHAEA0A7G8JUP5_9STRA
Match NameE-valueIdentityDescription
A0A3P3YW96_PLABS7.820e-3155.45Cytochrome c oxidase subunit 1 n=1 Tax=Plasmodioph... [more]
D6MQM8_9PHAE1.300e-3068.67Cytochrome c oxidase subunit 1 (Fragment) n=28 Tax... [more]
B4XPK9_9LILI2.840e-2967.47Cytochrome c oxidase subunit 1 (Fragment) n=9 Tax=... [more]
M1EYI5_9PHAE3.210e-2968.67Cytochrome c oxidase subunit 1 (Fragment) n=7 Tax=... [more]
M1F017_SARFS4.580e-2968.67Cytochrome c oxidase subunit 1 (Fragment) n=4 Tax=... [more]
Q33518_9BRYO5.090e-2968.67Cytochrome c oxidase subunit 1 (Fragment) n=2 Tax=... [more]
A0A8J5WG91_ZIZPA7.260e-2967.47Uncharacterized protein n=1 Tax=Zizania palustris ... [more]
A0A6M3TIB1_9FLOR9.310e-2966.27Cytochrome c oxidase subunit 1 (Fragment) n=1 Tax=... [more]
D4HL93_9PHAE1.020e-2868.67Cytochrome c oxidase subunit 1 (Fragment) n=24 Tax... [more]
A0A7G8JUP5_9STRA1.030e-2862.65Cytochrome c oxidase subunit 1 (Fragment) n=1 Tax=... [more]

Pages

back to top