prot_P-canaliculata_contig98984.24014.1 (polypeptide) Pelvetia canaliculata dioecious

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_P-canaliculata_contig98984.24014.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 15
ZOOM
x 1
POSITION
0
MAKRIVDEEMRFTIVVNGDKAQKELYDLEKSTRELTGRNKELRAEQAKLIASGQ5101520253035404550Expect = 4.86e-17 / Id = 79.25Expect = 5.23e-15 / Id = 73.58Expect = 3.28e-11 / Id = 66.67Expect = 4.48e-11 / Id = 76.74Expect = 8.37e-11 / Id = 100.00Expect = 5.46e-10 / Id = 62.26Expect = 7.47e-10 / Id = 65.31Expect = 9.12e-9 / Id = 71.79Expect = 1.12e-7 / Id = 54.72Expect = 3.91e-7 / Id = 54.72SequenceA0A5B2TW97_9FLAOUPI001AAFD4D9A0A385BJ74_9FLAOA0A2E6VDZ6_9FLAOUPI00047E2194A0A4Q0PNC7_9FLAOUPI0007FE11C6UPI00047B9900A0A1I7GLC2_9FLAOUPI001C5AF476
Match NameE-valueIdentityDescription
A0A5B2TW97_9FLAO4.860e-1779.25Phage tail tape measure protein n=1 Tax=Maribacter... [more]
UPI001AAFD4D95.230e-1573.58phage tail tape measure protein n=1 Tax=Salegentib... [more]
A0A385BJ74_9FLAO3.280e-1166.67Phage-related minor tail protein n=1 Tax=Marinifle... [more]
A0A2E6VDZ6_9FLAO4.480e-1176.74Phage tail tape measure protein n=1 Tax=Winogradsk... [more]
UPI00047E21948.370e-11100.00phage tail tape measure protein n=2 Tax=Maribacter... [more]
A0A4Q0PNC7_9FLAO5.460e-1062.26Tubulin-specific chaperone A n=1 Tax=Leeuwenhoekie... [more]
UPI0007FE11C67.470e-1065.31phage tail tape measure protein n=1 Tax=Tamlana sp... [more]
UPI00047B99009.120e-971.79phage tail tape measure protein n=1 Tax=Sediminiba... [more]
A0A1I7GLC2_9FLAO1.120e-754.72Phage tail tape measure protein, TP901 family, cor... [more]
UPI001C5AF4763.910e-754.72phage tail tape measure protein n=1 Tax=Flavobacte... [more]

Pages

back to top