prot_P-canaliculata_contig102292.362.1 (polypeptide) Pelvetia canaliculata dioecious
You are viewing a polypeptide, more information available on the corresponding mRNA page
Overview
Homology
BLAST of mRNA_P-canaliculata_contig102292.362.1 vs. uniprot
Match: D8LCS5_ECTSI (Dimer_Tnp_hAT domain-containing protein n=2 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LCS5_ECTSI) HSP 1 Score: 71.2 bits (173), Expect = 4.290e-13 Identity = 39/58 (67.24%), Postives = 44/58 (75.86%), Query Frame = 0 Query: 1 MEVSAFKTAPGLSVSKEVKGAT----VYNDPLDWWRKKEREYPLLAALARRVLAIPAS 54 MEVSAFK APG+ V K T V+N+PLD WRKK+ EYPLLAALARRVLAIP+S Sbjct: 453 MEVSAFKAAPGIRVWDMQKTNTGDKKVFNNPLDRWRKKQLEYPLLAALARRVLAIPSS 510
BLAST of mRNA_P-canaliculata_contig102292.362.1 vs. uniprot
Match: A0A6H5KUY5_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KUY5_9PHAE) HSP 1 Score: 70.1 bits (170), Expect = 1.100e-12 Identity = 33/55 (60.00%), Postives = 43/55 (78.18%), Query Frame = 0 Query: 1 MEVSAFKTAPGLSVSK-EVKGATVYNDPLDWWRKKEREYPLLAALARRVLAIPAS 54 +EV++F+T PG+S+ G VYNDPLDWWR ++ E+P LAALARRVLAIP+S Sbjct: 488 LEVASFQTTPGISIWYWGTDGKKVYNDPLDWWRTRQMEFPHLAALARRVLAIPSS 542
BLAST of mRNA_P-canaliculata_contig102292.362.1 vs. uniprot
Match: A0A6H5JWI1_9PHAE (Dimer_Tnp_hAT domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JWI1_9PHAE) HSP 1 Score: 62.0 bits (149), Expect = 6.310e-10 Identity = 31/55 (56.36%), Postives = 42/55 (76.36%), Query Frame = 0 Query: 1 MEVSAFKTAPGLSVSKEVK-GATVYNDPLDWWRKKEREYPLLAALARRVLAIPAS 54 +E++AFK + G+ + +E K GA VY DPLDWWR + ++P LA LARRVLAIPA+ Sbjct: 196 VELTAFKVSTGIKMYEEDKEGAKVYLDPLDWWRVRCADFPHLANLARRVLAIPAT 250
BLAST of mRNA_P-canaliculata_contig102292.362.1 vs. uniprot
Match: A0A0M8NXU4_9EURO (Dimer_Tnp_hAT domain-containing protein n=1 Tax=Penicillium nordicum TaxID=229535 RepID=A0A0M8NXU4_9EURO) HSP 1 Score: 48.9 bits (115), Expect = 3.190e-5 Identity = 22/41 (53.66%), Postives = 32/41 (78.05%), Query Frame = 0 Query: 14 VSKEVKGATVYNDPLDWWRKKEREYPLLAALARRVLAIPAS 54 +S+ +K TV DPL +WR+ ER+YP+LA+LAR +L IPA+ Sbjct: 114 LSQYLKNGTVEVDPLTFWRENERQYPVLASLARDILFIPAT 154
BLAST of mRNA_P-canaliculata_contig102292.362.1 vs. uniprot
Match: UPI001470A045 (zinc finger BED domain-containing protein 1-like isoform X1 n=2 Tax=Thalassophryne amazonica TaxID=390379 RepID=UPI001470A045) HSP 1 Score: 47.8 bits (112), Expect = 6.020e-5 Identity = 19/36 (52.78%), Postives = 27/36 (75.00%), Query Frame = 0 Query: 19 KGATVYNDPLDWWRKKEREYPLLAALARRVLAIPAS 54 K A + ++PL+WWR E+EYPLLA LA+R L +P + Sbjct: 132 KPAGLNDNPLNWWRSNEKEYPLLACLAKRYLCVPGT 167
BLAST of mRNA_P-canaliculata_contig102292.362.1 vs. uniprot
Match: A0A2I4C1R9_9TELE (uncharacterized protein LOC106524616 isoform X1 n=3 Tax=Austrofundulus limnaeus TaxID=52670 RepID=A0A2I4C1R9_9TELE) HSP 1 Score: 47.8 bits (112), Expect = 8.420e-5 Identity = 21/42 (50.00%), Postives = 31/42 (73.81%), Query Frame = 0 Query: 12 LSVSKEVKGATVYNDPLDWWRKKEREYPLLAALARRVLAIPA 53 +SV + KGA++ +PL WWR+K ++PLLA++AR LA PA Sbjct: 1086 MSVFRADKGASLGVEPLQWWRRKAAQFPLLASVARAYLAAPA 1127 The following BLAST results are available for this feature:
BLAST of mRNA_P-canaliculata_contig102292.362.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 6 ZOOMx 1POSITION0
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-canaliculata_contig102292.362.1 ID=prot_P-canaliculata_contig102292.362.1|Name=mRNA_P-canaliculata_contig102292.362.1|organism=Pelvetia canaliculata dioecious|type=polypeptide|length=55bpback to top |