prot_P-canaliculata_contig102.297.1 (polypeptide) Pelvetia canaliculata dioecious

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_P-canaliculata_contig102.297.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 25
ZOOM
x 1
POSITION
0
QSDNAHSFPLTMVRIKHRYLLINILYPDNKDPVALRSADETLENCYTIQFRRPSDDRVDARLLLRVVRDCVADLFGDYGSGKVASSLQVKYCSSATSTAIIRVAREHYRMVW102030405060708090100110Expect = 1.14e-37 / Id = 66.34Expect = 2.18e-37 / Id = 65.35Expect = 4.59e-37 / Id = 66.67Expect = 8.00e-37 / Id = 64.42Expect = 3.05e-36 / Id = 62.14Expect = 2.75e-35 / Id = 64.36Expect = 7.40e-35 / Id = 61.39Expect = 9.74e-35 / Id = 63.73Expect = 1.24e-34 / Id = 62.50Expect = 1.24e-34 / Id = 59.80SequenceA0A4U0UMR6_9PEZIA0A6A6CC76_9PEZIA0A4V5NF63_9PEZIA0A6A6Q801_9PEZIA0A3M7E2H6_HORWEUPI001D8759E7F9XJR2_ZYMTIUPI000CE17622UPI000CE1D794A0A6A6F854_9PEZI
Match NameE-valueIdentityDescription
A0A4U0UMR6_9PEZI1.140e-3766.34Uncharacterized protein n=1 Tax=Friedmanniomyces e... [more]
A0A6A6CC76_9PEZI2.180e-3765.35Uncharacterized protein n=1 Tax=Zasmidium cellare ... [more]
A0A4V5NF63_9PEZI4.590e-3766.67Uncharacterized protein n=2 Tax=Friedmanniomyces s... [more]
A0A6A6Q801_9PEZI8.000e-3764.42Rpp14/Pop5 family-domain-containing protein n=1 Ta... [more]
A0A3M7E2H6_HORWE3.050e-3662.14Ribonuclease P/MRP protein subunit POP5 n=15 Tax=H... [more]
UPI001D8759E72.750e-3564.36Ribonuclease P/MRP protein subunit POP5 n=1 Tax=Pa... [more]
F9XJR2_ZYMTI7.400e-3561.39Uncharacterized protein n=5 Tax=Zymoseptoria TaxID... [more]
UPI000CE176229.740e-3563.73ribonuclease P/MRP protein subunit POP5-like n=1 T... [more]
UPI000CE1D7941.240e-3462.50ribonuclease P/MRP protein subunit POP5-like n=1 T... [more]
A0A6A6F854_9PEZI1.240e-3459.80Uncharacterized protein (Fragment) n=1 Tax=Cercosp... [more]

Pages

back to top