prot_P-canaliculata_contig101956.286.1 (polypeptide) Pelvetia canaliculata dioecious

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_P-canaliculata_contig101956.286.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 25
ZOOM
x 1
POSITION
0
MTPSLTNFLTSLIAGGLIVVLPISFALFFVSKKDALTRVPTKK*510152025303540Expect = 3.79e-17 / Id = 90.70Expect = 3.13e-16 / Id = 88.37Expect = 3.13e-16 / Id = 86.05Expect = 5.21e-15 / Id = 83.72Expect = 1.75e-13 / Id = 81.40Expect = 5.04e-13 / Id = 79.07Expect = 1.55e-10 / Id = 74.42Expect = 3.14e-10 / Id = 69.77Expect = 5.11e-9 / Id = 67.44Expect = 1.03e-7 / Id = 71.05SequenceD1J769_ECTSIA0A6G6D7E9_ECTSIA0A8F0F7I0_9PHAEA0A344PF83_9PHAEA0A2R4QPT4_9PHAEA0A1L2F1S9_9PHAEA0A2I4Q2Y0_9PHAEA0A6P0NFK4_9CYANA0A7S6U9U3_9STRAA0A1C9CCW8_9RHOD
Match NameE-valueIdentityDescription
D1J769_ECTSI3.790e-1790.70Photosystem II reaction center X protein n=1 Tax=E... [more]
A0A6G6D7E9_ECTSI3.130e-1688.37Photosystem II reaction center X protein n=29 Tax=... [more]
A0A8F0F7I0_9PHAE3.130e-1686.05Photosystem II reaction center X protein n=1 Tax=P... [more]
A0A344PF83_9PHAE5.210e-1583.72Photosystem II reaction center X protein n=5 Tax=E... [more]
A0A2R4QPT4_9PHAE1.750e-1381.40Photosystem II reaction center X protein n=2 Tax=F... [more]
A0A1L2F1S9_9PHAE5.040e-1379.07Photosystem II reaction center X protein n=14 Tax=... [more]
A0A2I4Q2Y0_9PHAE1.550e-1074.42Photosystem II reaction center X protein n=1 Tax=D... [more]
A0A6P0NFK4_9CYAN3.140e-1069.77Photosystem II reaction center X protein n=1 Tax=M... [more]
A0A7S6U9U3_9STRA5.110e-967.44Photosystem II reaction center X protein n=1 Tax=S... [more]
A0A1C9CCW8_9RHOD1.030e-771.05Photosystem II reaction center X protein n=1 Tax=B... [more]

Pages

back to top