prot_P-canaliculata_contig101935.283.1 (polypeptide) Pelvetia canaliculata dioecious

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_P-canaliculata_contig101935.283.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 25
ZOOM
x 1
POSITION
0
MTDSSEIDFDHLNQYVSGDPDLTREVFGLFRNQVEMWGRGLTADADDDMWANVTHSLKGSARAVGAMGLAEACEKAEELVGDDRRPGAREVSVQTLEQRIEQVLNEIIRWEYKDDMRRLRSS*102030405060708090100110120Expect = 4.64e-62 / Id = 79.34Expect = 3.48e-44 / Id = 62.61Expect = 7.20e-43 / Id = 63.48Expect = 1.02e-42 / Id = 61.34Expect = 6.67e-42 / Id = 53.33Expect = 4.61e-34 / Id = 53.72Expect = 8.04e-33 / Id = 53.91Expect = 2.43e-32 / Id = 52.50Expect = 6.94e-32 / Id = 53.04Expect = 2.84e-26 / Id = 46.55SequenceUPI00198C3A71UPI00041CDFABA0A8J3CNE6_9PROTA0A420WK33_9PROTA0A848V4L3_9PROTA0A2G1YV19_9PROTA0A7V5U1B2_9PROTA0A2G2MY62_9PROTUPI0003A67511A0A7C5QRE9_9PROT
Match NameE-valueIdentityDescription
UPI00198C3A714.640e-6279.34Uncharacterized protein n=2 Tax=Litorimonas cladop... [more]
UPI00041CDFAB3.480e-4462.61Hpt domain-containing protein n=1 Tax=Hellea balne... [more]
A0A8J3CNE6_9PROT7.200e-4363.48HPt domain-containing protein n=1 Tax=Algimonas ar... [more]
A0A420WK33_9PROT1.020e-4261.34Hpt domain-containing protein n=2 Tax=Litorimonas ... [more]
A0A848V4L3_9PROT6.670e-4253.33Hpt domain-containing protein n=1 Tax=Hellea sp. T... [more]
A0A2G1YV19_9PROT4.610e-3453.72HPt domain-containing protein n=1 Tax=Robiginitoma... [more]
A0A7V5U1B2_9PROT8.040e-3353.91HPt domain-containing protein n=1 Tax=Hellea balne... [more]
A0A2G2MY62_9PROT2.430e-3252.50HPt domain-containing protein n=1 Tax=Robiginitoma... [more]
UPI0003A675116.940e-3253.04Hpt domain-containing protein n=1 Tax=Robiginitoma... [more]
A0A7C5QRE9_9PROT2.840e-2646.55HPt domain-containing protein n=1 Tax=Hellea balne... [more]

Pages

back to top