prot_P-canaliculata_contig101148.202.1 (polypeptide) Pelvetia canaliculata dioecious

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_P-canaliculata_contig101148.202.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 9
ZOOM
x 1
POSITION
0
PVNEDNAWGYLNAEGTMVIPPRYDDAYGFDQGIAAVVQNGVAQYIDTKGRRVWPR*510152025303540455055Expect = 4.77e-9 / Id = 57.14Expect = 1.63e-7 / Id = 44.23Expect = 4.23e-7 / Id = 44.23Expect = 1.08e-6 / Id = 51.11Expect = 1.38e-6 / Id = 41.30Expect = 1.80e-5 / Id = 45.65Expect = 1.83e-5 / Id = 54.55Expect = 6.33e-5 / Id = 47.50Expect = 6.39e-5 / Id = 42.00SequenceC6DZC6_GEOSMA0A142L309_9BACTA0A850LBV8_9BACTUPI000BAAA282UPI001C11C1B0A0A329LBP0_9BACLA0A521W5V1_9GAMMA0A660MJK9_9GAMMA0A8J7HB44_9FIRM
Match NameE-valueIdentityDescription
C6DZC6_GEOSM4.770e-957.14KWG Leptospira repeat protein n=1 Tax=Geobacter sp... [more]
A0A142L309_9BACT1.630e-744.23Uncharacterized protein n=2 Tax=unclassified Bacte... [more]
A0A850LBV8_9BACT4.230e-744.23WG repeat-containing protein n=1 Tax=Flavobacterii... [more]
UPI000BAAA2821.080e-651.11WG repeat-containing protein n=1 Tax=Actibacterium... [more]
UPI001C11C1B01.380e-641.30WG repeat-containing protein n=1 Tax=Alkaliphilus ... [more]
A0A329LBP0_9BACL1.800e-545.65Uncharacterized protein n=2 Tax=Paenibacillus sp. ... [more]
A0A521W5V1_9GAMM1.830e-554.55WG repeat-containing protein n=1 Tax=Gammaproteoba... [more]
A0A660MJK9_9GAMM6.330e-547.50WG repeat-containing protein n=1 Tax=Cardiobacteri... [more]
A0A8J7HB44_9FIRM6.390e-542.00WG repeat-containing protein n=1 Tax=Mobilitalea s... [more]
back to top