prot_P-canaliculata_contig100690.144.1 (polypeptide) Pelvetia canaliculata dioecious

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_P-canaliculata_contig100690.144.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 4
ZOOM
x 1
POSITION
0
VRRLLLILLISISSVTFAQQPAPDCQCRAPGGLMKDLGTVACFNIVGNNRMVRCEMSTNTPYWKELEGVAGCPDA*10203040506070Expect = 3.34e-26 / Id = 63.64Expect = 3.53e-6 / Id = 35.48Expect = 5.53e-5 / Id = 38.78Expect = 7.99e-5 / Id = 31.58SequenceA0A848UJ31_9GAMMA0A1L9NUX6_9RHOBUPI001CD32B46UPI001FEB0642
Match NameE-valueIdentityDescription
A0A848UJ31_9GAMM3.340e-2663.64Uncharacterized protein n=2 Tax=Granulosicoccus sp... [more]
A0A1L9NUX6_9RHOB3.530e-635.48Uncharacterized protein n=1 Tax=Planktotalea frisi... [more]
UPI001CD32B465.530e-538.78hypothetical protein n=1 Tax=Cognatishimia sp. MH4... [more]
UPI001FEB06427.990e-531.58hypothetical protein n=1 Tax=Planktotalea arctica ... [more]
back to top