prot_P-canaliculata_contig100690.144.1 (polypeptide) Pelvetia canaliculata dioecious
You are viewing a polypeptide, more information available on the corresponding mRNA page
Overview
Homology
BLAST of mRNA_P-canaliculata_contig100690.144.1 vs. uniprot
Match: A0A848UJ31_9GAMM (Uncharacterized protein n=2 Tax=Granulosicoccus sp. TaxID=1943584 RepID=A0A848UJ31_9GAMM) HSP 1 Score: 100 bits (250), Expect = 3.340e-26 Identity = 42/66 (63.64%), Postives = 54/66 (81.82%), Query Frame = 0 Query: 12 ISSVTFAQQP--APDCQCRAPGGLMKDLGTVACFNIVGNNRMVRCEMSTNTPYWKELEGVAGCPDA 75 +S++ + Q P APDC+CRAP G M+DLGTV C +IVG ++VRCEMSTNTPYWK+++GV GCPDA Sbjct: 30 VSALVWGQDPPVAPDCKCRAPDGQMRDLGTVQCVDIVGTRKLVRCEMSTNTPYWKKVDGVEGCPDA 95
BLAST of mRNA_P-canaliculata_contig100690.144.1 vs. uniprot
Match: A0A1L9NUX6_9RHOB (Uncharacterized protein n=1 Tax=Planktotalea frisia TaxID=696762 RepID=A0A1L9NUX6_9RHOB) HSP 1 Score: 50.1 bits (118), Expect = 3.530e-6 Identity = 22/62 (35.48%), Postives = 32/62 (51.61%), Query Frame = 0 Query: 11 SISSVTFAQQPAPDCQCRAPGGLMKDLGTVACFNIVGNNRMVRCEMSTNTPYWKELEGVAGC 72 S + VT +C C GGL +LG + C + G M +C+MS N+P W+E+ GC Sbjct: 16 SFADVTSPSGKTVECYCTDKGGLRIELGQMTCLQVDGRMFMAQCQMSLNSPMWREV--APGC 75
BLAST of mRNA_P-canaliculata_contig100690.144.1 vs. uniprot
Match: UPI001CD32B46 (hypothetical protein n=1 Tax=Cognatishimia sp. MH4019 TaxID=2854030 RepID=UPI001CD32B46) HSP 1 Score: 47.0 bits (110), Expect = 5.530e-5 Identity = 19/49 (38.78%), Postives = 28/49 (57.14%), Query Frame = 0 Query: 24 DCQCRAPGGLMKDLGTVACFNIVGNNRMVRCEMSTNTPYWKELEGVAGC 72 DC C GG +LG + C N+ G +C+MS N+P W+E++ GC Sbjct: 27 DCYCTDQGGERIELGEMICLNVGGRMFTAQCQMSLNSPMWREVQN--GC 73
BLAST of mRNA_P-canaliculata_contig100690.144.1 vs. uniprot
Match: UPI001FEB0642 (hypothetical protein n=1 Tax=Planktotalea arctica TaxID=1481893 RepID=UPI001FEB0642) HSP 1 Score: 46.6 bits (109), Expect = 7.990e-5 Identity = 24/76 (31.58%), Postives = 37/76 (48.68%), Query Frame = 0 Query: 2 RRLLLILLISISSVTFAQQPAP-----DCQCRAPGGLMKDLGTVACFNIVGNNRMVRCEMSTNTPYWKELEGVAGC 72 R++L LL + + A +P DC C G +LG + C + G M +C+MS N+P W+E+ GC Sbjct: 2 RKVLTFLLCAAPMIAGADVTSPSGRTVDCYCTDKSGARLELGQMTCIQVDGRMFMAQCQMSLNSPMWREIS--KGC 75 The following BLAST results are available for this feature:
BLAST of mRNA_P-canaliculata_contig100690.144.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 4 ZOOMx 1POSITION0
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-canaliculata_contig100690.144.1 ID=prot_P-canaliculata_contig100690.144.1|Name=mRNA_P-canaliculata_contig100690.144.1|organism=Pelvetia canaliculata dioecious|type=polypeptide|length=76bpback to top |