prot_P-canaliculata_contig100361.96.1 (polypeptide) Pelvetia canaliculata dioecious

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_P-canaliculata_contig100361.96.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 13
ZOOM
x 1
POSITION
0
SLSNPRSYELLGELPELYSLWIDHNDLKSLPVTLGAISQIRFLYIEHNGLEQLPEEISGMKKLWVLHAGYNNFRELPLEFTNMNSLLMVHINNNQIQNVAEDFHTKKYPLKGLILDNNVLSPTEIKYAKYIFKDFFMLSFEQKE*20406080100120140Expect = 7.11e-15 / Id = 71.33Expect = 2.09e-14 / Id = 44.06Expect = 2.76e-12 / Id = 74.83Expect = 5.22e-12 / Id = 72.73Expect = 5.26e-12 / Id = 72.03Expect = 5.55e-12 / Id = 73.72Expect = 2.43e-11 / Id = 65.49Expect = 4.90e-11 / Id = 73.72Expect = 1.19e-9 / Id = 73.43Expect = 5.33e-8 / Id = 69.72SequenceA0A5B1BFY9_9FLAOUPI001357E40BUPI001C580898A0A554VRY7_9FLAOUPI000465AB7CA0A3B7BZK1_9FLAOA0A504JE51_9FLAOUPI00191E6A74A0A3A9VG52_9FLAOA0A1M6AUY8_9FLAO
Match NameE-valueIdentityDescription
A0A5B1BFY9_9FLAO7.110e-1571.33Leucine-rich repeat domain-containing protein n=1 ... [more]
UPI001357E40B2.090e-1444.06hypothetical protein n=1 Tax=Aquimarina sp. AU474 ... [more]
UPI001C5808982.760e-1274.83hypothetical protein n=1 Tax=Aquimarina litoralis ... [more]
A0A554VRY7_9FLAO5.220e-1272.73Uncharacterized protein n=2 Tax=Aquimarina TaxID=2... [more]
UPI000465AB7C5.260e-1272.03leucine-rich repeat domain-containing protein n=1 ... [more]
A0A3B7BZK1_9FLAO5.550e-1273.72Leucine-rich repeat domain-containing protein n=3 ... [more]
A0A504JE51_9FLAO2.430e-1165.49Leucine-rich repeat domain-containing protein n=1 ... [more]
UPI00191E6A744.900e-1173.72hypothetical protein n=1 Tax=Aquimarina mytili Tax... [more]
A0A3A9VG52_9FLAO1.190e-973.43Uncharacterized protein n=1 Tax=Aquimarina sp. BL5... [more]
A0A1M6AUY8_9FLAO5.330e-869.72Uncharacterized protein n=1 Tax=Aquimarina spongia... [more]

Pages

back to top