prot_P-canaliculata_contig100356.95.1 (polypeptide) Pelvetia canaliculata dioecious
You are viewing a polypeptide, more information available on the corresponding mRNA page
Overview
Homology
BLAST of mRNA_P-canaliculata_contig100356.95.1 vs. uniprot
Match: UPI0016765D31 ((2Fe-2S)-binding protein n=1 Tax=Litorimonas cladophorae TaxID=1220491 RepID=UPI0016765D31) HSP 1 Score: 109 bits (272), Expect = 3.690e-30 Identity = 52/63 (82.54%), Postives = 57/63 (90.48%), Query Frame = 0 Query: 1 MIHCICNNINTAKVDAAAANGAETAACVQRACGTRFNCGQCRVDIQSRLQAWRIANPALEAAE 63 MIHCICNNINTAKVDAAAA GAETAACVQ+ACGTRFNCGQCRVDI +RL++ R NP L+AAE Sbjct: 1 MIHCICNNINTAKVDAAAAQGAETAACVQKACGTRFNCGQCRVDIDARLRSLRALNPILQAAE 63
BLAST of mRNA_P-canaliculata_contig100356.95.1 vs. uniprot
Match: UPI00167B3EB6 ((2Fe-2S)-binding protein n=1 Tax=Algimonas arctica TaxID=1479486 RepID=UPI00167B3EB6) HSP 1 Score: 100 bits (248), Expect = 1.700e-26 Identity = 46/63 (73.02%), Postives = 52/63 (82.54%), Query Frame = 0 Query: 1 MIHCICNNINTAKVDAAAANGAETAACVQRACGTRFNCGQCRVDIQSRLQAWRIANPALEAAE 63 MIHCICNNINT V+AAAA GAETAACVQRACG+RF CGQCR DI+ L++WR P L+AAE Sbjct: 1 MIHCICNNINTKAVEAAAAKGAETAACVQRACGSRFRCGQCRTDIEQHLRSWRQTRPMLDAAE 63
BLAST of mRNA_P-canaliculata_contig100356.95.1 vs. uniprot
Match: UPI00041620B7 ((2Fe-2S)-binding protein n=1 Tax=Hellea balneolensis TaxID=287478 RepID=UPI00041620B7) HSP 1 Score: 98.6 bits (244), Expect = 1.230e-25 Identity = 46/63 (73.02%), Postives = 51/63 (80.95%), Query Frame = 0 Query: 1 MIHCICNNINTAKVDAAAANGAETAACVQRACGTRFNCGQCRVDIQSRLQAWRIANPALEAAE 63 MIHC+CNNINTAKVD AA+ GAE A V R CGT+FNCGQCRV I +RL+ WR NPALEAAE Sbjct: 22 MIHCLCNNINTAKVDIAASQGAERAKDVMRVCGTKFNCGQCRVSINARLEEWRAINPALEAAE 84
BLAST of mRNA_P-canaliculata_contig100356.95.1 vs. uniprot
Match: A0A520XME1_9ACTN ((2Fe-2S)-binding protein n=1 Tax=Acidimicrobiales bacterium TaxID=2201156 RepID=A0A520XME1_9ACTN) HSP 1 Score: 60.1 bits (144), Expect = 1.200e-10 Identity = 35/63 (55.56%), Postives = 39/63 (61.90%), Query Frame = 0 Query: 1 MIHCICNNINTAKVDAAAANGAETAACVQRACGTRFNCGQCRVDIQSRLQAWRIANPALEAAE 63 MIHC+CN INT KVD AAA GA CVQ G +FNCG+C I+ RL A LEAAE Sbjct: 1 MIHCLCNQINTKKVDEAAACGARRPKCVQAHFGHKFNCGKCAQSIRERL-AEISGVDYLEAAE 62
BLAST of mRNA_P-canaliculata_contig100356.95.1 vs. uniprot
Match: UPI0018F02B14 (hypothetical protein n=1 Tax=Robiginitomaculum antarcticum TaxID=437507 RepID=UPI0018F02B14) HSP 1 Score: 53.5 bits (127), Expect = 6.040e-8 Identity = 29/49 (59.18%), Postives = 31/49 (63.27%), Query Frame = 0 Query: 1 MIHCICNNINTAKVDAAAANGAETAACVQRACGTRFNCGQCRVDIQSRL 49 MIHC+CNNINTAKVD AA GA V G FNCGQC+ I RL Sbjct: 1 MIHCVCNNINTAKVDEAAHAGACRPKDVLAHHGKAFNCGQCKGSIAERL 49 The following BLAST results are available for this feature:
BLAST of mRNA_P-canaliculata_contig100356.95.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 5 ZOOMx 1POSITION0
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-canaliculata_contig100356.95.1 ID=prot_P-canaliculata_contig100356.95.1|Name=mRNA_P-canaliculata_contig100356.95.1|organism=Pelvetia canaliculata dioecious|type=polypeptide|length=64bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|