prot_P-canaliculata_contig100356.95.1 (polypeptide) Pelvetia canaliculata dioecious

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_P-canaliculata_contig100356.95.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 5
ZOOM
x 1
POSITION
0
MIHCICNNINTAKVDAAAANGAETAACVQRACGTRFNCGQCRVDIQSRLQAWRIANPALEAAE*51015202530354045505560Expect = 3.69e-30 / Id = 82.54Expect = 1.70e-26 / Id = 73.02Expect = 1.23e-25 / Id = 73.02Expect = 1.20e-10 / Id = 55.56Expect = 6.04e-8 / Id = 59.18SequenceUPI0016765D31UPI00167B3EB6UPI00041620B7A0A520XME1_9ACTNUPI0018F02B14
Match NameE-valueIdentityDescription
UPI0016765D313.690e-3082.54(2Fe-2S)-binding protein n=1 Tax=Litorimonas clado... [more]
UPI00167B3EB61.700e-2673.02(2Fe-2S)-binding protein n=1 Tax=Algimonas arctica... [more]
UPI00041620B71.230e-2573.02(2Fe-2S)-binding protein n=1 Tax=Hellea balneolens... [more]
A0A520XME1_9ACTN1.200e-1055.56(2Fe-2S)-binding protein n=1 Tax=Acidimicrobiales ... [more]
UPI0018F02B146.040e-859.18hypothetical protein n=1 Tax=Robiginitomaculum ant... [more]
back to top