prot_P-canaliculata_contig10011.60.1 (polypeptide) Pelvetia canaliculata dioecious

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_P-canaliculata_contig10011.60.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 10
ZOOM
x 1
POSITION
0
NADLDLHVFEPGGEEVYFGERLGDVGIMSDDSTEGFGSETYTLLNGLAIDEDEILGTYRAWVTNGQPGTPWVMTARLAGELEWTIYGVIPANYSYDDNRTFYPVTVTEYTESTCDIDLYGTCPEGSFSDDGT102030405060708090100110120130Expect = 5.76e-6 / Id = 43.01Expect = 2.48e-5 / Id = 40.24Expect = 4.00e-5 / Id = 36.05Expect = 4.14e-5 / Id = 52.27Expect = 4.49e-5 / Id = 50.00Expect = 4.80e-5 / Id = 35.29Expect = 6.06e-5 / Id = 51.02Expect = 7.83e-5 / Id = 34.69Expect = 8.04e-5 / Id = 34.69Expect = 8.18e-5 / Id = 45.76SequenceUPI0013EBC1F3UPI001BE1B650A0A2N7ND05_9VIBRA0A6U3UJW2_9STRAA0A1M5TDE1_9FLAOA0A1U7GDE0_9BACTA0A850BLY1_9DELTUPI001F16BF7AA0A0Q8VQ02_9ACTNA0A7X7WA44_9THEM
Match NameE-valueIdentityDescription
UPI0013EBC1F35.760e-643.01hypothetical protein n=1 Tax=unclassified Paludisp... [more]
UPI001BE1B6502.480e-540.24hypothetical protein n=1 Tax=Dyadobacter sp. CECT ... [more]
A0A2N7ND05_9VIBR4.000e-536.05Uncharacterized protein n=5 Tax=Vibrio TaxID=662 R... [more]
A0A6U3UJW2_9STRA4.140e-552.27Hypothetical protein n=1 Tax=Ditylum brightwellii ... [more]
A0A1M5TDE1_9FLAO4.490e-550.00TonB-dependent outer membrane receptor, SusC/RagA ... [more]
A0A1U7GDE0_9BACT4.800e-535.29Uncharacterized protein n=1 Tax=Planctomycetales b... [more]
A0A850BLY1_9DELT6.060e-551.02VWA domain-containing protein n=1 Tax=Polyangiacea... [more]
UPI001F16BF7A7.830e-534.69putative Ig domain-containing protein n=1 Tax=uncl... [more]
A0A0Q8VQ02_9ACTN8.040e-534.69IPT/TIG domain-containing protein n=2 Tax=unclassi... [more]
A0A7X7WA44_9THEM8.180e-545.76Uncharacterized protein (Fragment) n=1 Tax=Thermot... [more]
back to top