mRNA_P-canaliculata_contig102.303.1 (mRNA) Pelvetia canaliculata dioecious
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_P-canaliculata_contig102.303.1 vs. uniprot
Match: UPI0004E9D82F (Pre-rRNA-processing protein ESF2 n=1 Tax=Passalora fulva TaxID=5499 RepID=UPI0004E9D82F) HSP 1 Score: 51.2 bits (121), Expect = 2.960e-5 Identity = 36/75 (48.00%), Postives = 45/75 (60.00%), Query Frame = 1 Query: 58 MSARKRNEYLEGYESEDDNANGYDSEAVEDSRT--GHGSKRRRVEADSSDEETLHDGGGVVVVKESRHLGTTDKN 276 MS RKRNE+LEG E+E++ NGYDSEA E G G+KRR+V+A S D + G V VKE G K+ Sbjct: 1 MSTRKRNEFLEGDETEEEIENGYDSEAEEGRGALGGRGNKRRKVDATSDDSD-----GDVENVKEPPKAGAIVKD 70 The following BLAST results are available for this feature:
BLAST of mRNA_P-canaliculata_contig102.303.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-canaliculata_contig102.303.1 >prot_P-canaliculata_contig102.303.1 ID=prot_P-canaliculata_contig102.303.1|Name=mRNA_P-canaliculata_contig102.303.1|organism=Pelvetia canaliculata dioecious|type=polypeptide|length=104bp AQTSDLGPVVQHFHHISNTMSARKRNEYLEGYESEDDNANGYDSEAVEDSback to top mRNA from alignment at P-canaliculata_contig102:36335..36646+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-canaliculata_contig102.303.1 ID=mRNA_P-canaliculata_contig102.303.1|Name=mRNA_P-canaliculata_contig102.303.1|organism=Pelvetia canaliculata dioecious|type=mRNA|length=312bp|location=Sequence derived from alignment at P-canaliculata_contig102:36335..36646+ (Pelvetia canaliculata dioecious)back to top Coding sequence (CDS) from alignment at P-canaliculata_contig102:36335..36646+ >mRNA_P-canaliculata_contig102.303.1 ID=mRNA_P-canaliculata_contig102.303.1|Name=mRNA_P-canaliculata_contig102.303.1|organism=Pelvetia canaliculata dioecious|type=CDS|length=624bp|location=Sequence derived from alignment at P-canaliculata_contig102:36335..36646+ (Pelvetia canaliculata dioecious)back to top |