mRNA_P-canaliculata_contig10165.257.1 (mRNA) Pelvetia canaliculata dioecious
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_P-canaliculata_contig10165.257.1 vs. uniprot
Match: A0A6H5JSR9_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JSR9_9PHAE) HSP 1 Score: 80.9 bits (198), Expect = 3.740e-16 Identity = 38/65 (58.46%), Postives = 49/65 (75.38%), Query Frame = 1 Query: 73 LTVLSVSVDGKIVAWDAVVKSERYHMQHPPDEEVASMLVLPGGQLMATGTGNGNVRFWRLDTGVG 267 L VLS S++G I AW+ + KSE+Y M+H EV SMLVLPGG ++ TGT +G+VRFW+LDTG G Sbjct: 95 LVVLSASLNGVIRAWETLGKSEKYCMRHSGGAEVTSMLVLPGGSVLVTGTDDGSVRFWQLDTGAG 159
BLAST of mRNA_P-canaliculata_contig10165.257.1 vs. uniprot
Match: D8LC79_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LC79_ECTSI) HSP 1 Score: 80.5 bits (197), Expect = 9.940e-16 Identity = 38/65 (58.46%), Postives = 49/65 (75.38%), Query Frame = 1 Query: 73 LTVLSVSVDGKIVAWDAVVKSERYHMQHPPDEEVASMLVLPGGQLMATGTGNGNVRFWRLDTGVG 267 L VLS S++G I AW+ + KSE+Y M+H EV SMLVLPGG ++ TGT +G+VRFW+LDTG G Sbjct: 567 LVVLSASMNGVIRAWETLGKSEKYCMRHSGGVEVTSMLVLPGGSVLVTGTDDGSVRFWQLDTGAG 631 The following BLAST results are available for this feature:
BLAST of mRNA_P-canaliculata_contig10165.257.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-canaliculata_contig10165.257.1 >prot_P-canaliculata_contig10165.257.1 ID=prot_P-canaliculata_contig10165.257.1|Name=mRNA_P-canaliculata_contig10165.257.1|organism=Pelvetia canaliculata dioecious|type=polypeptide|length=89bp YQPDEDQLDDGTPNEEEKIEGDLVLTVLSVSVDGKIVAWDAVVKSERYHMback to top mRNA from alignment at P-canaliculata_contig10165:1980..2426+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-canaliculata_contig10165.257.1 ID=mRNA_P-canaliculata_contig10165.257.1|Name=mRNA_P-canaliculata_contig10165.257.1|organism=Pelvetia canaliculata dioecious|type=mRNA|length=447bp|location=Sequence derived from alignment at P-canaliculata_contig10165:1980..2426+ (Pelvetia canaliculata dioecious)back to top Coding sequence (CDS) from alignment at P-canaliculata_contig10165:1980..2426+ >mRNA_P-canaliculata_contig10165.257.1 ID=mRNA_P-canaliculata_contig10165.257.1|Name=mRNA_P-canaliculata_contig10165.257.1|organism=Pelvetia canaliculata dioecious|type=CDS|length=534bp|location=Sequence derived from alignment at P-canaliculata_contig10165:1980..2426+ (Pelvetia canaliculata dioecious)back to top |