prot_M-pyrifera_M_contig100209.46.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig100209.46.1 vs. uniprot
Match: A0A7S3GD04_9EUKA (Hypothetical protein n=1 Tax=Palpitomonas bilix TaxID=652834 RepID=A0A7S3GD04_9EUKA) HSP 1 Score: 58.5 bits (140), Expect = 8.580e-9 Identity = 32/65 (49.23%), Postives = 42/65 (64.62%), Query Frame = 0 Query: 7 RALCAAVERSETLEVLVLRNCQIATWCVESLRKALGHSKTLRRVDLRGNPLGRDGVREVVEGLKQ 71 ++ AAV S LE L LRNC ++ C+ESL AL S++LRRVD+R N LGRDG ++ L Q Sbjct: 90 KSFFAAVASSSQLEELDLRNCALSPSCLESLCHALAVSRSLRRVDIRWNNLGRDGGAALLSALSQ 154
BLAST of mRNA_M-pyrifera_M_contig100209.46.1 vs. uniprot
Match: UPI000643AD2A (NACHT, LRR and PYD domains-containing protein 4 n=1 Tax=Condylura cristata TaxID=143302 RepID=UPI000643AD2A) HSP 1 Score: 53.9 bits (128), Expect = 1.690e-6 Identity = 29/66 (43.94%), Postives = 40/66 (60.61%), Query Frame = 0 Query: 5 GFRALCAAVERSET-LEVLVLRNCQIATWCVESLRKALGHSKTLRRVDLRGNPLGRDGVREVVEGL 69 G LC A+ + LE L L +CQ+ + C +L AL +KTL ++DLRGNPLG GV E+ + L Sbjct: 822 GVATLCEALAHPDCRLEQLGLGHCQLTSACCGALAAALVSTKTLEKLDLRGNPLGHSGVAELCQAL 887
BLAST of mRNA_M-pyrifera_M_contig100209.46.1 vs. uniprot
Match: UPI00188F0C6B (NACHT, LRR and PYD domains-containing protein 4-like n=1 Tax=Talpa occidentalis TaxID=50954 RepID=UPI00188F0C6B) HSP 1 Score: 52.0 bits (123), Expect = 8.100e-6 Identity = 30/66 (45.45%), Postives = 41/66 (62.12%), Query Frame = 0 Query: 5 GFRALCAAVER-SETLEVLVLRNCQIATWCVESLRKALGHSKTLRRVDLRGNPLGRDGVREVVEGL 69 G ALC A+ S LE L L +C++ + C L AL +KTL+++DLRGN LGR GV E+ + L Sbjct: 879 GAAALCEALAHPSCRLEKLGLSHCRLTSACCGDLAAALVSTKTLQKLDLRGNALGRGGVAELCQAL 944 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig100209.46.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 3
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig100209.46.1 ID=prot_M-pyrifera_M_contig100209.46.1|Name=mRNA_M-pyrifera_M_contig100209.46.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=82bpback to top |