mRNA_M-pyrifera_M_contig100209.46.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig100209.46.1 vs. uniprot
Match: A0A7S3GD04_9EUKA (Hypothetical protein n=1 Tax=Palpitomonas bilix TaxID=652834 RepID=A0A7S3GD04_9EUKA) HSP 1 Score: 65.1 bits (157), Expect = 3.220e-11 Identity = 35/77 (45.45%), Postives = 49/77 (63.64%), Query Frame = 1 Query: 1 EWNALGMDRAGFRALCAAVERSETLEVLVLRNCQIATWCVESLRKALGHSKTLRRVDLRGNPLGRDGVREVVEGLKQ 231 +WN++G + ++ AAV S LE L LRNC ++ C+ESL AL S++LRRVD+R N LGRDG ++ L Q Sbjct: 78 DWNSIGAVPSIAKSFFAAVASSSQLEELDLRNCALSPSCLESLCHALAVSRSLRRVDIRWNNLGRDGGAALLSALSQ 154
BLAST of mRNA_M-pyrifera_M_contig100209.46.1 vs. uniprot
Match: UPI000643AD2A (NACHT, LRR and PYD domains-containing protein 4 n=1 Tax=Condylura cristata TaxID=143302 RepID=UPI000643AD2A) HSP 1 Score: 53.5 bits (127), Expect = 2.910e-6 Identity = 29/66 (43.94%), Postives = 40/66 (60.61%), Query Frame = 1 Query: 31 GFRALCAAVERSET-LEVLVLRNCQIATWCVESLRKALGHSKTLRRVDLRGNPLGRDGVREVVEGL 225 G LC A+ + LE L L +CQ+ + C +L AL +KTL ++DLRGNPLG GV E+ + L Sbjct: 822 GVATLCEALAHPDCRLEQLGLGHCQLTSACCGALAAALVSTKTLEKLDLRGNPLGHSGVAELCQAL 887
BLAST of mRNA_M-pyrifera_M_contig100209.46.1 vs. uniprot
Match: UPI00188F0C6B (NACHT, LRR and PYD domains-containing protein 4-like n=1 Tax=Talpa occidentalis TaxID=50954 RepID=UPI00188F0C6B) HSP 1 Score: 51.6 bits (122), Expect = 1.390e-5 Identity = 30/66 (45.45%), Postives = 41/66 (62.12%), Query Frame = 1 Query: 31 GFRALCAAVER-SETLEVLVLRNCQIATWCVESLRKALGHSKTLRRVDLRGNPLGRDGVREVVEGL 225 G ALC A+ S LE L L +C++ + C L AL +KTL+++DLRGN LGR GV E+ + L Sbjct: 879 GAAALCEALAHPSCRLEKLGLSHCRLTSACCGDLAAALVSTKTLQKLDLRGNALGRGGVAELCQAL 944 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig100209.46.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig100209.46.1 >prot_M-pyrifera_M_contig100209.46.1 ID=prot_M-pyrifera_M_contig100209.46.1|Name=mRNA_M-pyrifera_M_contig100209.46.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=82bp MDRAGFRALCAAVERSETLEVLVLRNCQIATWCVESLRKALGHSKTLRRVback to top mRNA from alignment at M-pyrifera_M_contig100209:1..264+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig100209.46.1 ID=mRNA_M-pyrifera_M_contig100209.46.1|Name=mRNA_M-pyrifera_M_contig100209.46.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=264bp|location=Sequence derived from alignment at M-pyrifera_M_contig100209:1..264+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig100209:1..264+ >mRNA_M-pyrifera_M_contig100209.46.1 ID=mRNA_M-pyrifera_M_contig100209.46.1|Name=mRNA_M-pyrifera_M_contig100209.46.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=492bp|location=Sequence derived from alignment at M-pyrifera_M_contig100209:1..264+ (Macrocystis pyrifera P11B4 male)back to top |