mRNA_M-pyrifera_M_contig101262.272.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig101262.272.1 vs. uniprot
Match: A0A2E8LGP2_9ACTN (Uncharacterized protein n=6 Tax=Acidimicrobiaceae bacterium TaxID=2024894 RepID=A0A2E8LGP2_9ACTN) HSP 1 Score: 87.0 bits (214), Expect = 2.160e-21 Identity = 43/49 (87.76%), Postives = 44/49 (89.80%), Query Frame = 1 Query: 1 LADLAIQRLRESIDAGGTELPVDEKRLTRARRAVEKAVHLLEEPDSDPW 147 LADLAI RLRESIDAGGTE PVDEKRLTRARRAVEKA+HLLEEPD W Sbjct: 22 LADLAIVRLRESIDAGGTEYPVDEKRLTRARRAVEKAIHLLEEPDDRAW 70
BLAST of mRNA_M-pyrifera_M_contig101262.272.1 vs. uniprot
Match: A0A7C7SAH3_9ACTN (Uncharacterized protein n=2 Tax=Acidimicrobiia TaxID=84992 RepID=A0A7C7SAH3_9ACTN) HSP 1 Score: 85.5 bits (210), Expect = 8.130e-21 Identity = 41/49 (83.67%), Postives = 45/49 (91.84%), Query Frame = 1 Query: 1 LADLAIQRLRESIDAGGTELPVDEKRLTRARRAVEKAVHLLEEPDSDPW 147 +ADLAI RLRESIDAGGTELPVDE+RLTRARRAV+KAVHLL+EPD W Sbjct: 19 MADLAIMRLRESIDAGGTELPVDERRLTRARRAVDKAVHLLDEPDDAGW 67
BLAST of mRNA_M-pyrifera_M_contig101262.272.1 vs. uniprot
Match: A0A3D5K1N8_9ACTN (Uncharacterized protein n=3 Tax=root TaxID=1 RepID=A0A3D5K1N8_9ACTN) HSP 1 Score: 84.0 bits (206), Expect = 3.310e-20 Identity = 41/49 (83.67%), Postives = 43/49 (87.76%), Query Frame = 1 Query: 1 LADLAIQRLRESIDAGGTELPVDEKRLTRARRAVEKAVHLLEEPDSDPW 147 LADLA+ RLRESIDAGG ELPVDEKRLTRARRAVEKA HLL+EPD W Sbjct: 19 LADLALVRLRESIDAGGQELPVDEKRLTRARRAVEKAAHLLDEPDRSDW 67
BLAST of mRNA_M-pyrifera_M_contig101262.272.1 vs. uniprot
Match: A0A382V1W6_9ZZZZ (Uncharacterized protein (Fragment) n=1 Tax=marine metagenome TaxID=408172 RepID=A0A382V1W6_9ZZZZ) HSP 1 Score: 82.8 bits (203), Expect = 6.550e-20 Identity = 40/49 (81.63%), Postives = 44/49 (89.80%), Query Frame = 1 Query: 1 LADLAIQRLRESIDAGGTELPVDEKRLTRARRAVEKAVHLLEEPDSDPW 147 LADLAI RLRESIDAGGTELP DE+R+TRARRAVEKAVHLL+EP+ W Sbjct: 4 LADLAILRLRESIDAGGTELPFDERRITRARRAVEKAVHLLDEPEDGGW 52
BLAST of mRNA_M-pyrifera_M_contig101262.272.1 vs. uniprot
Match: A0A7X5WSY6_9ACTN (Uncharacterized protein n=1 Tax=Actinomycetia bacterium TaxID=1883427 RepID=A0A7X5WSY6_9ACTN) HSP 1 Score: 82.0 bits (201), Expect = 1.920e-19 Identity = 41/45 (91.11%), Postives = 44/45 (97.78%), Query Frame = 1 Query: 1 LADLAIQRLRESIDAGGTELPVDEKRLTRARRAVEKAVHLLEEPD 135 LADLA+ RLRESIDAGG+ELPVDEKRLTRARRAVEKAVHLL+EPD Sbjct: 19 LADLALIRLRESIDAGGSELPVDEKRLTRARRAVEKAVHLLDEPD 63
BLAST of mRNA_M-pyrifera_M_contig101262.272.1 vs. uniprot
Match: A0A2D9PUA6_9ACTN (Uncharacterized protein n=1 Tax=Acidimicrobiaceae bacterium TaxID=2024894 RepID=A0A2D9PUA6_9ACTN) HSP 1 Score: 81.6 bits (200), Expect = 2.730e-19 Identity = 39/49 (79.59%), Postives = 44/49 (89.80%), Query Frame = 1 Query: 1 LADLAIQRLRESIDAGGTELPVDEKRLTRARRAVEKAVHLLEEPDSDPW 147 LADLAI RLRESIDAGGTELP+DE+R+TRARRAVEKA HLL+EP+ W Sbjct: 19 LADLAILRLRESIDAGGTELPLDERRITRARRAVEKAAHLLDEPNDGGW 67
BLAST of mRNA_M-pyrifera_M_contig101262.272.1 vs. uniprot
Match: A0A381Q4Y9_9ZZZZ (Uncharacterized protein n=1 Tax=marine metagenome TaxID=408172 RepID=A0A381Q4Y9_9ZZZZ) HSP 1 Score: 80.1 bits (196), Expect = 8.230e-19 Identity = 40/47 (85.11%), Postives = 43/47 (91.49%), Query Frame = 1 Query: 1 LADLAIQRLRESIDAGGTELPVDEKRLTRARRAVEKAVHLLEEPDSD 141 LADLAIQRLRESID GG ELPVDE+RLTRARRAVEKA +LLEEPD + Sbjct: 8 LADLAIQRLRESIDVGGDELPVDERRLTRARRAVEKAAYLLEEPDDN 54
BLAST of mRNA_M-pyrifera_M_contig101262.272.1 vs. uniprot
Match: A0A6B1B344_9ACTN (Uncharacterized protein n=1 Tax=Acidimicrobiaceae bacterium TaxID=2024894 RepID=A0A6B1B344_9ACTN) HSP 1 Score: 80.1 bits (196), Expect = 1.110e-18 Identity = 40/45 (88.89%), Postives = 42/45 (93.33%), Query Frame = 1 Query: 1 LADLAIQRLRESIDAGGTELPVDEKRLTRARRAVEKAVHLLEEPD 135 LADLAI RLRESIDAGG ELPVDE+RLTRARRAVEKA+HLL EPD Sbjct: 19 LADLAIVRLRESIDAGGQELPVDERRLTRARRAVEKAIHLLSEPD 63
BLAST of mRNA_M-pyrifera_M_contig101262.272.1 vs. uniprot
Match: A0A2E0ZTA9_9ACTN (Uncharacterized protein n=2 Tax=Acidimicrobiaceae bacterium TaxID=2024894 RepID=A0A2E0ZTA9_9ACTN) HSP 1 Score: 80.1 bits (196), Expect = 1.200e-18 Identity = 39/50 (78.00%), Postives = 44/50 (88.00%), Query Frame = 1 Query: 1 LADLAIQRLRESIDAGGTELPVDEKRLTRARRAVEKAVHLLEEPDSDPWS 150 LADLAI RLRESIDAGG LPVDE+RLTRARRAVEKA++LL+EPD W+ Sbjct: 19 LADLAIIRLRESIDAGGNXLPVDERRLTRARRAVEKAINLLQEPDDSGWA 68
BLAST of mRNA_M-pyrifera_M_contig101262.272.1 vs. uniprot
Match: A0A2E5NUW2_9ACTN (Uncharacterized protein n=1 Tax=Acidimicrobiaceae bacterium TaxID=2024894 RepID=A0A2E5NUW2_9ACTN) HSP 1 Score: 79.3 bits (194), Expect = 2.130e-18 Identity = 40/45 (88.89%), Postives = 43/45 (95.56%), Query Frame = 1 Query: 1 LADLAIQRLRESIDAGGTELPVDEKRLTRARRAVEKAVHLLEEPD 135 LADLA+ RLRESIDAGG ELPVDEKRLTRARRAVEKA++LLEEPD Sbjct: 19 LADLALVRLRESIDAGGHELPVDEKRLTRARRAVEKAINLLEEPD 63 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig101262.272.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig101262.272.1 >prot_M-pyrifera_M_contig101262.272.1 ID=prot_M-pyrifera_M_contig101262.272.1|Name=mRNA_M-pyrifera_M_contig101262.272.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=55bp LADLAIQRLRESIDAGGTELPVDEKRLTRARRAVEKAVHLLEEPDSDPWSback to top mRNA from alignment at M-pyrifera_M_contig101262:507..671- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig101262.272.1 ID=mRNA_M-pyrifera_M_contig101262.272.1|Name=mRNA_M-pyrifera_M_contig101262.272.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=165bp|location=Sequence derived from alignment at M-pyrifera_M_contig101262:507..671- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig101262:507..671- >mRNA_M-pyrifera_M_contig101262.272.1 ID=mRNA_M-pyrifera_M_contig101262.272.1|Name=mRNA_M-pyrifera_M_contig101262.272.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=330bp|location=Sequence derived from alignment at M-pyrifera_M_contig101262:507..671- (Macrocystis pyrifera P11B4 male)back to top |