prot_M-pyrifera_M_contig99249.22831.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig99249.22831.1 vs. uniprot
Match: A0A6H5JHB7_9PHAE (C2H2-type domain-containing protein n=2 Tax=Ectocarpus TaxID=2879 RepID=A0A6H5JHB7_9PHAE) HSP 1 Score: 60.5 bits (145), Expect = 1.220e-9 Identity = 27/33 (81.82%), Postives = 32/33 (96.97%), Query Frame = 0 Query: 1 QGILSKNKDLKKAFGTENQLEACKIILDKGEMQ 33 +G+L+KNKDL KAFGT+NQLEAC+IILDKGEMQ Sbjct: 64 KGVLAKNKDLMKAFGTDNQLEACRIILDKGEMQ 96
BLAST of mRNA_M-pyrifera_M_contig99249.22831.1 vs. uniprot
Match: A0A0B2VZK2_TOXCA (Ribosome maturation protein SBDS n=4 Tax=Ascaridoidea TaxID=33256 RepID=A0A0B2VZK2_TOXCA) HSP 1 Score: 47.4 bits (111), Expect = 4.720e-5 Identity = 19/33 (57.58%), Postives = 29/33 (87.88%), Query Frame = 0 Query: 1 QGILSKNKDLKKAFGTENQLEACKIILDKGEMQ 33 +G+++K ++L AFGTE+QLE CK+ILDKG++Q Sbjct: 64 KGLIAKREELNAAFGTEDQLEICKLILDKGDLQ 96
BLAST of mRNA_M-pyrifera_M_contig99249.22831.1 vs. uniprot
Match: UPI0001CBA9C6 (ribosome maturation protein SBDS-like n=1 Tax=Saccoglossus kowalevskii TaxID=10224 RepID=UPI0001CBA9C6) HSP 1 Score: 47.0 bits (110), Expect = 6.480e-5 Identity = 22/37 (59.46%), Postives = 29/37 (78.38%), Query Frame = 0 Query: 1 QGILSKNKDLKKAFGTENQLEACKIILDKGEMQARER 37 +G +SK +DLK+AFGTE+Q E CK+IL KGE Q E+ Sbjct: 62 KGQVSKKEDLKRAFGTEDQTEICKMILAKGEFQVSEK 98 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig99249.22831.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 3
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig99249.22831.1 ID=prot_M-pyrifera_M_contig99249.22831.1|Name=mRNA_M-pyrifera_M_contig99249.22831.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=37bpback to top |