mRNA_M-pyrifera_M_contig90815.21048.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig90815.21048.1 vs. uniprot
Match: I7M0I5_TETTS (RNA recognition motif protein n=1 Tax=Tetrahymena thermophila (strain SB210) TaxID=312017 RepID=I7M0I5_TETTS) HSP 1 Score: 49.3 bits (116), Expect = 2.300e-5 Identity = 15/34 (44.12%), Postives = 25/34 (73.53%), Query Frame = 1 Query: 61 KQGAKRCPHCLIYAVKVDGCDWIKCGRCEHGWCW 162 K+GA++CP+C +Y +++DGC ++C RC CW Sbjct: 1645 KEGARKCPNCGVYIIRIDGCYRVECRRCNQHICW 1678
BLAST of mRNA_M-pyrifera_M_contig90815.21048.1 vs. uniprot
Match: T2M4D7_HYDVU (RBR-type E3 ubiquitin transferase n=1 Tax=Hydra vulgaris TaxID=6087 RepID=T2M4D7_HYDVU) HSP 1 Score: 48.5 bits (114), Expect = 4.250e-5 Identity = 17/48 (35.42%), Postives = 29/48 (60.42%), Query Frame = 1 Query: 19 LLKTAEQDEKQCVAKQGAKRCPHCLIYAVKVDGCDWIKCGRCEHGWCW 162 L + E+ + + +K+CP+C Y K+DGC+ +KC +CE +CW Sbjct: 356 LKQAVEEHFSETWLENNSKKCPNCSTYIEKIDGCNKMKCYKCETNFCW 403 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig90815.21048.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig90815.21048.1 >prot_M-pyrifera_M_contig90815.21048.1 ID=prot_M-pyrifera_M_contig90815.21048.1|Name=mRNA_M-pyrifera_M_contig90815.21048.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=54bp GVCETALLKTAEQDEKQCVAKQGAKRCPHCLIYAVKVDGCDWIKCGRCEHback to top mRNA from alignment at M-pyrifera_M_contig90815:27..188+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig90815.21048.1 ID=mRNA_M-pyrifera_M_contig90815.21048.1|Name=mRNA_M-pyrifera_M_contig90815.21048.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=162bp|location=Sequence derived from alignment at M-pyrifera_M_contig90815:27..188+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig90815:27..188+ >mRNA_M-pyrifera_M_contig90815.21048.1 ID=mRNA_M-pyrifera_M_contig90815.21048.1|Name=mRNA_M-pyrifera_M_contig90815.21048.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=324bp|location=Sequence derived from alignment at M-pyrifera_M_contig90815:27..188+ (Macrocystis pyrifera P11B4 male)back to top |