mRNA_M-pyrifera_M_contig90661.21020.1 (mRNA) Macrocystis pyrifera P11B4 male
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig90661.21020.1 vs. uniprot
Match: A0A2P6N7W0_9EUKA (Uncharacterized protein n=1 Tax=Planoprotostelium fungivorum TaxID=1890364 RepID=A0A2P6N7W0_9EUKA) HSP 1 Score: 55.1 bits (131), Expect = 1.010e-6 Identity = 33/88 (37.50%), Postives = 41/88 (46.59%), Query Frame = 1 Query: 1 CEGCNDGAVCEGEGHMAASQGYWQSRQDSWEFYDCEVFRFACCPHGNCTAGA---DAPCAMGRRGVLCAECDEGYSSMGPTAPCVPCE 255 C C D C E A GYW + D E + C V CP C A ++ C RRGVLC EC+EGY+ T+ C+P E Sbjct: 573 CSPCPDHVTCTTEKTPQAQGGYWCAVDDGGEEFTCHV-----CPDQYCRADDHDWNSSCNDNRRGVLCGECEEGYTLAFLTSKCMPRE 655
BLAST of mRNA_M-pyrifera_M_contig90661.21020.1 vs. uniprot
Match: A0A8J8NGL8_HALGN (Uncharacterized protein n=1 Tax=Halteria grandinella TaxID=5974 RepID=A0A8J8NGL8_HALGN) HSP 1 Score: 50.1 bits (118), Expect = 5.950e-5 Identity = 27/85 (31.76%), Postives = 41/85 (48.24%), Query Frame = 1 Query: 1 CEGCND-GAVCEGEGHMAASQGYWQSRQDSWEFYDCEVFRFACCPHGNCTAGADAPCAMGRRGVLCAECDEGYSSMGPTAPCVPC 252 C+ C D + C G + GYW+ S +F C ++ +AC + A CA G +G+LCA+C +GYS + C C Sbjct: 776 CKKCQDLVSECPGGNEIYPLPGYWRISNQSDDFLKC-LYPYACNGRQQLSNNAQGTCAEGYQGILCADCQKGYSKSHSSNRCSQC 859 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig90661.21020.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig90661.21020.1 >prot_M-pyrifera_M_contig90661.21020.1 ID=prot_M-pyrifera_M_contig90661.21020.1|Name=mRNA_M-pyrifera_M_contig90661.21020.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=93bp CEGCNDGAVCEGEGHMAASQGYWQSRQDSWEFYDCEVFRFACCPHGNCTAback to top mRNA from alignment at M-pyrifera_M_contig90661:6..284- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig90661.21020.1 ID=mRNA_M-pyrifera_M_contig90661.21020.1|Name=mRNA_M-pyrifera_M_contig90661.21020.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=279bp|location=Sequence derived from alignment at M-pyrifera_M_contig90661:6..284- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig90661:6..284- >mRNA_M-pyrifera_M_contig90661.21020.1 ID=mRNA_M-pyrifera_M_contig90661.21020.1|Name=mRNA_M-pyrifera_M_contig90661.21020.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=558bp|location=Sequence derived from alignment at M-pyrifera_M_contig90661:6..284- (Macrocystis pyrifera P11B4 male)back to top |