prot_M-pyrifera_M_contig89550.20762.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig89550.20762.1 vs. uniprot
Match: A0A518AQU1_9BACT (Uncharacterized protein n=1 Tax=Aeoliella mucimassa TaxID=2527972 RepID=A0A518AQU1_9BACT) HSP 1 Score: 58.5 bits (140), Expect = 9.660e-8 Identity = 35/105 (33.33%), Postives = 57/105 (54.29%), Query Frame = 0 Query: 10 CPTCGKPGLGKKEEWCTGCGFYPRLGIQIEVDPDPE-----DHPPAPE---TAMDIVKQTPTWAFVLFGGLLVLLGISIAVRLTIPVSNIARPLWAIGQFLLGMM 106 C C P + +++ C CG++ LGI +E+D + E D PAP+ T +I + P+WA L +V++ +S+AVRL IP +I W + Q +G+M Sbjct: 29 CKRCESP-MDEEQPVCFECGYHTTLGITVEIDREWEAAANPDSAPAPQQQDTWQEITQSIPSWAATLAVPNVVIIAMSLAVRLLIPRESIILEFWGVWQLAIGLM 132 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig89550.20762.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig89550.20762.1 ID=prot_M-pyrifera_M_contig89550.20762.1|Name=mRNA_M-pyrifera_M_contig89550.20762.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=109bpback to top |