mRNA_M-pyrifera_M_contig87569.20338.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig87569.20338.1 vs. uniprot
Match: A0A3D5DHL5_9GAMM (Mismatch-specific DNA-glycosylase n=1 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A3D5DHL5_9GAMM) HSP 1 Score: 55.5 bits (132), Expect = 4.890e-8 Identity = 23/41 (56.10%), Postives = 30/41 (73.17%), Query Frame = 1 Query: 25 SLEWGAQAQLCAGAAVFVTPNPSAANAAYSFDDIVRWMDRL 147 S++WG Q CAGA +F++PNPS ANAAYS +I W D+L Sbjct: 131 SIDWGEQKSSCAGAVIFISPNPSTANAAYSLAEITAWYDKL 171
BLAST of mRNA_M-pyrifera_M_contig87569.20338.1 vs. uniprot
Match: A0A1T2L345_9GAMM (UDG domain-containing protein n=2 Tax=Gammaproteobacteria incertae sedis TaxID=118884 RepID=A0A1T2L345_9GAMM) HSP 1 Score: 52.8 bits (125), Expect = 5.510e-7 Identity = 25/49 (51.02%), Postives = 31/49 (63.27%), Query Frame = 1 Query: 1 YAQGVRFESLEWGAQAQLCAGAAVFVTPNPSAANAAYSFDDIVRWMDRL 147 Y Q VR S+EWG Q++ + VFVTPNPS ANAA+S + W RL Sbjct: 136 YTQNVRVPSIEWGEQSERIGNSMVFVTPNPSPANAAFSLQVLTEWDQRL 184
BLAST of mRNA_M-pyrifera_M_contig87569.20338.1 vs. uniprot
Match: A0A7V5UAW6_9GAMM (Mismatch-specific DNA-glycosylase n=1 Tax=Chromatiales bacterium TaxID=2026725 RepID=A0A7V5UAW6_9GAMM) HSP 1 Score: 52.0 bits (123), Expect = 1.230e-6 Identity = 26/48 (54.17%), Postives = 32/48 (66.67%), Query Frame = 1 Query: 4 AQGVRFESLEWGAQAQLCAGAAVFVTPNPSAANAAYSFDDIVRWMDRL 147 A G+ F + WG Q + AG VFV+PNPS ANAA+S DD+VR D L Sbjct: 140 AVGLSFSNDHWGLQQETVAGLPVFVSPNPSPANAAFSLDDLVRCYDEL 187
BLAST of mRNA_M-pyrifera_M_contig87569.20338.1 vs. uniprot
Match: A0A1G0JT32_9GAMM (UDG domain-containing protein n=1 Tax=Gammaproteobacteria bacterium RIFCSPLOWO2_02_FULL_52_10 TaxID=1798297 RepID=A0A1G0JT32_9GAMM) HSP 1 Score: 47.8 bits (112), Expect = 3.940e-5 Identity = 21/41 (51.22%), Postives = 29/41 (70.73%), Query Frame = 1 Query: 25 SLEWGAQAQLCAGAAVFVTPNPSAANAAYSFDDIVRWMDRL 147 ++ WGAQ L + VFVTPNPS ANA YS DD++++ D + Sbjct: 130 TIPWGAQKYLIGKSRVFVTPNPSPANAQYSLDDLIKYYDAM 170 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig87569.20338.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 4
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig87569.20338.1 >prot_M-pyrifera_M_contig87569.20338.1 ID=prot_M-pyrifera_M_contig87569.20338.1|Name=mRNA_M-pyrifera_M_contig87569.20338.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=49bp YAQGVRFESLEWGAQAQLCAGAAVFVTPNPSAANAAYSFDDIVRWMDRLback to top mRNA from alignment at M-pyrifera_M_contig87569:683..829- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig87569.20338.1 ID=mRNA_M-pyrifera_M_contig87569.20338.1|Name=mRNA_M-pyrifera_M_contig87569.20338.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=147bp|location=Sequence derived from alignment at M-pyrifera_M_contig87569:683..829- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig87569:683..829- >mRNA_M-pyrifera_M_contig87569.20338.1 ID=mRNA_M-pyrifera_M_contig87569.20338.1|Name=mRNA_M-pyrifera_M_contig87569.20338.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=294bp|location=Sequence derived from alignment at M-pyrifera_M_contig87569:683..829- (Macrocystis pyrifera P11B4 male)back to top |