prot_M-pyrifera_M_contig100918.201.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig100918.201.1 vs. uniprot
Match: D7G7R3_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G7R3_ECTSI) HSP 1 Score: 63.9 bits (154), Expect = 1.590e-9 Identity = 35/90 (38.89%), Postives = 50/90 (55.56%), Query Frame = 0 Query: 26 RELLCGLCSQLMMDASVLPCSHAFCELCISRHLRRVTFPRTDPACPTCHHRTPALPCAHRCVLVDNLVMQLLRGLP-TVERGKWERRVVE 114 R+ +CGLCS+L++DA+VLPCSH+FC LC + H+ T P C H + P RC +D L+ ++ L ER +W R E Sbjct: 224 RDAMCGLCSELLLDAAVLPCSHSFCRLCWAEHVEEKGT--TCPVCLRKMHSSERTP--RRCSNLDLLITSIIHKLAGPEERARWTARQEE 309
BLAST of mRNA_M-pyrifera_M_contig100918.201.1 vs. uniprot
Match: A0A6H5KYS2_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KYS2_9PHAE) HSP 1 Score: 63.2 bits (152), Expect = 2.970e-9 Identity = 35/90 (38.89%), Postives = 50/90 (55.56%), Query Frame = 0 Query: 26 RELLCGLCSQLMMDASVLPCSHAFCELCISRHLRRVTFPRTDPACPTCHHRTPALPCAHRCVLVDNLVMQLLRGLP-TVERGKWERRVVE 114 R+ +CGLCS+L++DA+VLPCSH+FC LC + H+ T P C H + P RC +D L+ ++ L ER +W R E Sbjct: 234 RDAMCGLCSELLLDAAVLPCSHSFCRLCWAGHVEEKGT--TCPVCLRKMHSSERTP--RRCSNLDLLITSIIHKLAGPQERARWTARQEE 319
BLAST of mRNA_M-pyrifera_M_contig100918.201.1 vs. uniprot
Match: W7TPZ6_9STRA (E3 ubiquitin-protein ligase CHFR n=1 Tax=Nannochloropsis gaditana TaxID=72520 RepID=W7TPZ6_9STRA) HSP 1 Score: 53.1 bits (126), Expect = 1.000e-5 Identity = 25/45 (55.56%), Postives = 31/45 (68.89%), Query Frame = 0 Query: 24 LRRELLCGLCSQLMMDASVLPCSHAFCELCISRHLRRVTFPRTDP 68 L EL C LCS+++MDA VLPCSHAFC C+ R+L+ P DP Sbjct: 486 LEAELGCALCSEIVMDAGVLPCSHAFCFSCVHRYLK--AGPDKDP 528
BLAST of mRNA_M-pyrifera_M_contig100918.201.1 vs. uniprot
Match: A0A4D9D4J4_9STRA (E3 ubiquitin-protein ligase CHFR n=1 Tax=Nannochloropsis salina CCMP1776 TaxID=1027361 RepID=A0A4D9D4J4_9STRA) HSP 1 Score: 50.4 bits (119), Expect = 8.870e-5 Identity = 24/45 (53.33%), Postives = 30/45 (66.67%), Query Frame = 0 Query: 24 LRRELLCGLCSQLMMDASVLPCSHAFCELCISRHLRRVTFPRTDP 68 L EL C LCS+++MDA VLPCSHAFC C+ +L+ P DP Sbjct: 427 LEAELGCALCSEIVMDAGVLPCSHAFCFSCVHTYLK--DGPDKDP 469 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig100918.201.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 4
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig100918.201.1 ID=prot_M-pyrifera_M_contig100918.201.1|Name=mRNA_M-pyrifera_M_contig100918.201.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=115bpback to top |